improved chimeric antigenic receptors and uses thereof

专利摘要:
The present invention relates to methods and compositions for improving the immune response to cancers and pathogens. Refers to the novel designs of chimeric antigenic receptors (CARs) and genetically modified immunoresponsive cells comprising them. The genetically modified immunoresponsive cells comprising the unprecedented CARs are directed to the antigen and have extended persistence without compromising function.
公开号:BR112020012039A2
申请号:R112020012039-1
申请日:2018-12-31
公开日:2020-11-24
发明作者:Michel Sadelain；Judith Feucht；Mohamad Hamieh；Jie Sun；Jorge A. Mansilla-Soto
申请人:Memorial Sloan-Kettering Cancer Center；
IPC主号:

专利说明:

[001] [001] This application claims priority of U.S. provisional application 62 / 612,031, filed on December 29, 2017, the content of which is incorporated herein by reference in its entirety, and for which the priority is claimed. INTRODUCTION
[002] [002] The subject in question currently described provides methods and compositions to improve the immune response in relation to cancers and pathogens. It is related to the novel designs of chimeric antigenic receptors (CARs) and genetically modified immunoresponsive cells comprising them. The genetically modified immunoresponsive cells, comprising the unprecedented CARs, are directed to the antigen and have extended persistence without compromising function. BACKGROUND OF THE TECHNIQUE
[003] [003] Therapy with chimeric antigen receptor (CAR) has achieved great clinical success against hematological malignancies (PMID: 23515080). It is based on synthetic receptors with both antigen recognition and signal transduction functions (PMID: 20467460). The single chain variable fragment (scFv) in a CAR maintains its antigen recognition specificity from the variable regions of the heavy and light chains of the original monoclonal antibody. However, signal transduction of the CAR construct is highly dependent on the signaling domains of the original immune receptors. Currently, all versions of second generation CARs in clinical trials have two signaling capabilities / modalities, since they contain domains from two immune receptors, one being CD37 and the other being a co-stimulatory receptor, such as CD28 or 41BB (PMID: 26129802). In short, it combines the two signals transduced by separate receivers into a synthetic receiver. Presumably, signal transduction in CARs may be similar to that in CD37 and CD28 / 41BB.
[004] [004] CD37 is part of a multimeric T cell antigen receptor (TCR) complex that binds to the antigen and transduces the binding across the plasma membrane into intracellular signals. While TCRabB (or TCRyS) subunits recognize antigens by means of their specific extracellular regions, CD3Ç mainly performs signal transduction functions in the complex through its three - immunoreceptor-to-base-activation-motifs tyrosine - (ITAMs) well maintained (PMID: 20516133). First, identified based on their sequence homology, ITAMs consist of two consecutive YxxL / I motifs, separated by a defined number of amino acids (YxxL / I-Xe-8-YxxL / 1I) (PMID: 2927501). ITAMs are generally found in receptors expressed on hematopoietic cells, and are especially well studied in the context of TCR signaling. The binding of TOR to peptide-MHC leads to the activation of an Lck kinase of the Src family, which phosphorylates two tyrosine residues in each of the three ITAMs on CD37 (PMID: 25861978). Each bisphosphorylated ITAM then gains the ability to bind to the two tandem SH2 domains of a Syk family kinase, ZAP-70. This interaction leads ZAP-70 in close proximity to Lck, resulting in the phosphorylation and activation of ZAP-70 by Lck. Activated ZAP-70 additionally phosphorylates its downstream targets, such as adapter protein LAT and SLP-76. Phosphorylated LAT and SLP-76 provide scaffolding for many other proteins, such as PLC-y, Grb2 / Sos, Gads and Itk, Vav and Nck, eventually leading to calcium mobilization, Ras / Erk activation and actin cytoskeletal rearrangement, and finally the activation of gene expression (PMID: 20516133). Therefore, the three ITAMs on CD37 are the main, if not the only, signaling fractions in TCR signaling.
[005] [005] CD28, on the other hand, does not contain any ITAM. Instead, its cytoplasmic domain contains a YMNM motif that, once phosphorylated by binding CD28 to its CD80 / CD86 ligand, can bind to the p85 subunit of PISK and Grb2 / Gads (PMID: 20534709). In addition, the proline-rich regions of CD28 can interact with Itk, Tec, Lck, Grb2 / Vav and philamine A (PMID: 20534709). Therefore, TCR signaling initiated by binding to the antigen by means of CD3C and CD28 signaling initiated by binding to CD80 / 86 share many common agents, such as Grb2, Vav, Gads, Lck, Itk, which promote cross-linking between these two possible ways. In addition, the activation of both pathways occurs in the signaling complexes assembled close to the plasma membrane, in the immunological synapse, physically bringing signaling molecules from the two pathways together in space. Last but not least, CD28-induced calcium signaling occurs seconds after TOR-initiated intracellular calcium increase, if not earlier, reflecting the temporal proximity / approximation of the two pathways (PMID: 18848472). SUMMARY OF THE INVENTION
[006] [006] The present description provides chimeric antigenic receptors (CARs) that bind to an antigen of interest. The CAR can be attached to a tumor antigen or a pathogen antigen. In certain non-limiting embodiments, the CAR comprises an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD376 polypeptide.
[007] [007] In certain embodiments, the modified CD37 polypeptide lacks all or part of the tyrosine-based immunoreceptor activation motifs (ITAMs), in which the ITAMs are ITAM1, ITAM2 and ITAM3. In certain embodiments, the modified CD36 polypeptide lacks ITAM2 or a portion of it. In certain embodiments, the modified CD36 polypeptide additionally lacks ITAM3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide additionally lacks ITAM1 or a portion thereof. In certain embodiments, the modified CD376 polypeptide lacks ITAM1 or a portion of it. In certain embodiments, the modified CD37 polypeptide additionally lacks ITAM3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide lacks ITAM3 or a portion of it. In certain embodiments, the modified CD37 polypeptide comprises an elimination of ITAM2 or a portion thereof. In certain embodiments, the modified CD37 polypeptide further comprises an elimination of ITAM3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide further comprises an elimination of ITAM1 or a portion thereof. In certain embodiments, the modified CD37 polypeptide comprises an elimination of ITAM1 or a portion thereof. In certain embodiments, the modified CD36 polypeptide further comprises an elimination of ITAM3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide comprises an elimination of ITAM3 or a portion thereof.
[008] [008] In certain embodiments, the modified CD36 polypeptide lacks additionally all or part of the regions of rich basic extension (BRS), where the BRS regions are BRS1, BRS2 and BRS3. In certain embodiments, the modified CD37 polypeptide lacks BRS2 or a portion thereof. In certain embodiments, the modified CD36 polypeptide additionally lacks BRS3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide additionally lacks BRS1 or a portion thereof. In certain embodiments, the modified CD37 polypeptide lacks BRS1 or a portion thereof. In certain embodiments, the modified CD36 polypeptide additionally lacks BRS3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide lacks BRS3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide lacks BRS1 or a portion thereof, BRS2 or a portion thereof, and BRS3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide comprises an elimination of BRS2 or a portion thereof. In certain embodiments, the modified CD36 polypeptide further comprises an elimination of BRS3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide further comprises an elimination of BRS1 or a portion thereof. In certain embodiments, the modified CD37 polypeptide comprises an elimination of BRS1 or a portion thereof. In certain embodiments, the modified CD37 polypeptide further comprises an elimination of BRS3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide comprises an elimination of BRS3 or a portion thereof. In certain embodiments, the modified CD376 polypeptide comprises an elimination of BRS1 or a portion thereof, BRS2 or a portion thereof, and BRS3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide comprises an elimination of ITAM2, ITAM3, BRS2 and BRS3. In certain embodiments, the modified CD37 polypeptide lacks ITAM2, ITAM3, BRS2 and BRS3. In certain embodiments, the CAR comprises the amino acid sequence shown in SEQ ID NO: 45 or SEQ ID NO: 47.
[009] [009] In certain embodiments, the modified CD37 polypeptide lacks all or part of the regions of rich basic extension (BRS), where the BRS regions are BRS1, BRS2 and BRS3. In certain embodiments, the modified CD376 polypeptide lacks BRS2 or a portion thereof. In certain embodiments, the modified CD37 polypeptide additionally lacks BRS3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide additionally lacks BRS1 or a portion thereof. In certain embodiments, the modified CD376 polypeptide lacks BRS1 or a portion thereof. In certain embodiments, the modified CD36 polypeptide additionally lacks BRS3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide lacks BRS3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide lacks BRS1 or a portion thereof, BRS2 or a portion thereof, and BRS3 or a portion thereof.
[010] [010] In certain embodiments, the modified CD36 polypeptide comprises a variation of BRS selected from a variation of BRS1, a variation of BRS 2, and a variation of BRS3, wherein the variation of BRS comprises one or more mutations with loss of function.
[011] [011] In certain embodiments, each of the various CARs described above additionally comprises a hinge / spacer region, wherein the hinge / spacer region comprises a CD8 polypeptide, a CD28 polypeptide, a CD36 polypeptide, a CD40 polypeptide, a polypeptide 4-1BB, an OX40 polypeptide, a CD84 polypeptide, a CD166 polypeptide, a polypeptide
[012] [012] In certain embodiments, the transmembrane domain of each of the various CARs described above comprises a CD8 polypeptide, a CD28 polypeptide, a CD37 polypeptide, a CD40 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, a CD84 polypeptide, a CD166 polypeptide, CD8a polypeptide, CD8b polypeptide, ICOS polypeptide, ICAM-1 polypeptide, CTLA-4 polypeptide, CD27 polypeptide, CD40 / My88 peptide, NKGD2 peptide or a combination thereof. In certain embodiments, the transmembrane domain comprises CD166 polypeptide. In certain embodiments, the transmembrane domain comprises CD166 polypeptide having amino acids 528 to 527 of SEQ ID NO: 3.
[013] [013] In certain embodiments, the transmembrane domain and the hinge / spacer region are derived from the same molecule. In certain embodiments, the hinge / spacer region comprises a CD28 polypeptide and the transmembrane domain comprises a CD28 polypeptide. In certain embodiments, the hinge / spacer region comprises a CD84 polypeptide and the transmembrane domain comprises a CD84 polypeptide. In certain embodiments, the hinge / spacer region comprises a CD166 polypeptide and the transmembrane domain comprises a CD1I66 polypeptide. In certain embodiments, the CAR comprises amino acids 489 to 553 of SEQ ID NO: 3.
[014] [014] In certain embodiments, the hinge / spacer region comprises a CD8a polypeptide and the transmembrane domain comprises a CD8a polypeptide. In certain embodiments, the hinge / spacer region comprises a CD8b polypeptide and the transmembrane domain comprises a CD8b polypeptide.
[015] [015] In certain embodiments, the transmembrane domain and the hinge / spacer region are derived from different molecules. In certain embodiments, the hinge / spacer region comprises a CD28 polypeptide and the transmembrane domain comprises an ICOS polypeptide.
[016] [016] In certain embodiments, the intracellular signaling domain of each of the various CARs described above further comprises a co-stimulatory signaling domain. In certain embodiments, the co-stimulatory signaling domain comprises a CD28 polypeptide.
[017] [017] The subject matter currently described also provides chimeric antigenic receptors (CARs) comprising an extracellular antigen binding domain, a hinge / spacer region, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, in that the modified CD36 polypeptide comprises a variation of ITAM comprising one or more mutations with loss of function, wherein the variation of ITAM is selected from the group consisting of a variation of ITAM1, a variation of ITAM2 and a variation of ITAM3. In certain embodiments, the hinge / spacer region comprises a CD8 polypeptide, a CD28 polypeptide, a CD36 polypeptide, a CD40 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, a CD84 polypeptide, a CD166 polypeptide, a CD8a polypeptide, a CD8b polypeptide, ICOS polypeptide, ICAM-1 polypeptide, CTLA-4 polypeptide, CD27 polypeptide, CD40 / My88 peptide, NKGD 2 peptide or a combination thereof. In certain embodiments, the variation of ITAM2 presents the amino acid sequence shown in SEQ ID NO: 29. In certain embodiments, the variation of ITAM3 presents the amino acid sequence shown in SEQ ID NO: 33. In certain embodiments, the CAR comprises a hinge / spacer region of a CD1I66 polypeptide and a transmembrane domain of a CD1I66 polypeptide. In certain embodiments, the CAR comprises amino acids 489 to 553 of SEQ ID NO: 3. In certain embodiments, the modified CD37 polypeptide has amino acids 374 to 485 of SEQ ID NO: 43.
[018] [018] The subject in question currently described also provides an immunoresponsive cell comprising a CAR described herein. In certain embodiments, CAR is expressed recombinantly. In certain modalities, the CAR is expressed from a vector. In certain embodiments, the CAR is placed in an endogenous gene locus of the immunoresponsive cell. In certain embodiments, the endogenous gene locus is a TRAC locus, a TRBC locus or a TRGC locus. In certain embodiments, the endogenous gene locus is a TRAC locus. In certain modalities, the positioning of the CAR interrupts or cancels the endogenous expression of a TCR.
[019] [019] The subject in question currently described also provides immunoresponsive cells comprising two or more CARs. In certain embodiments, the immunoresponsive cell comprises a) a first CAR comprising a first extracellular antigen binding domain that binds a first antigen, a first transmembrane domain, and a first intracellular signaling domain; and b) a second CAR comprising a second extracellular antigen binding domain that binds to a second antigen, a second transmembrane domain, and a second intracellular signaling domain, wherein the first CAR is a previously described CAR or the first domain of intracellular signaling comprises a modified CD36 polypeptide, which comprises one or more ITAM variations comprising one or more loss-of-function mutations, each of which one or more ITAM variations is independently selected from the group consisting of a variation of ITAM1 , a variation of ITAM2 and a variation of ITAM3. In certain embodiments, the first CAR additionally comprises a first hinge / spacer region. In certain embodiments, the second CAR additionally comprises a second hinge / spacer region. In certain embodiments, each of the first and second hinge / spacer regions can be independently selected from any of the hinge / spacer regions described herein.
[020] [020] In certain embodiments, the second CAR is a CAR described earlier. In certain embodiments, the second intracellular signaling domain of the second CAR comprises a modified CD37 polypeptide, which comprises one or more ITAM variants comprising one or more loss-of-function mutations, in which the ITAM variation is selected from the group consisting of a variation of ITAM1, a variation of ITAM2 and a variation of ITAM3. In certain embodiments, the second intracellular signaling domain of the second CAR comprises a modified CD36 polypeptide, which is the same as the modified CD36 polypeptide comprised in the first intracellular signaling domain of the first CAR. In certain embodiments, the second intracellular signaling domain of the second CAR comprises a modified CD36 polypeptide, which is different from the modified CD36 polypeptide comprised in the first intracellular signaling domain of the first CAR. In certain embodiments, the second intracellular signaling domain of the second CAR comprises a natural CD36 polypeptide.
[021] [021] In certain embodiments, the first intracellular signaling domain of the first CAR is the same as the second intracellular signaling domain of the second CAR. In certain embodiments, the first intracellular signaling domain of the first CAR is different from the second intracellular signaling domain of the second CAR.
[022] [022] In certain embodiments, the first antigen is different from the second antigen.
[023] [023] In certain embodiments, the first intracellular signaling domain comprises or exhibits a variation of ITAM2 and a variation of ITAM3, and the second intracellular signaling domain comprises or exhibits an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof.
[024] [024] In certain embodiments, the first intracellular signaling domain comprises or exhibits a variation of ITAM2 and a variation of ITAM3, and the second intracellular signaling domain comprises or exhibits a variation of ITAM1 and a variation of ITAM2.
[025] [025] In certain embodiments, the cell further comprises a third CAR comprising a third extracellular antigen binding domain that binds a third antigen, a third transmembrane domain, and a third intracellular signaling domain.
[026] [026] In certain embodiments, the first intracellular signaling domain comprises or exhibits a variation of ITAM2 and a variation of ITAM3, the second intracellular signaling domain comprises or exhibits an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof, and the third intracellular signaling domain comprises or exhibits a variation of ITAM1 and a variation of ITAM2.
[027] [027] In certain embodiments, the first intracellular signaling domain comprises or presents an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof, the second intracellular signaling domain comprises or presents an elimination of ITAM2 or a portion thereof, and a deletion of ITAM3 or a portion thereof, and the third intracellular signaling domain comprises or exhibits a variation of ITAM1 and a variation of ITAM2.
[028] [028] In certain embodiments, the first intracellular signaling domain comprises or presents an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof, the second intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM2, and the third domain of intracellular signaling comprises or exhibits a variation of ITAM1 and a variation of ITAM2.
[029] [029] In certain embodiments, the first intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM2, the second intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM2, and the third domain of Intracellular signaling comprises or presents a variation of ITAM1 and a variation of ITAM2.
[030] [030] In certain embodiments, the cell is selected from the group consisting of a T cell, a natural killer cell (NK), a human embryonic stem cell, and a pluripotent stem cell from which lymphoid cells can be differentiated. In certain embodiments, the cell is a T cell. In certain embodiments, the T cell is selected from the group consisting of a cytotoxic T lymphocyte (CTL), a regulatory T cell, and a natural killer T cell (NKT). In certain embodiments, the immunoresponsive cell is a myeloid cell such as a macrophage. In certain embodiments, said immunoresponsive cell is autologous. In certain embodiments, said antigen is a tumor antigen. In certain embodiments, the tumor antigen is selected from the group consisting of CD19, MUC16, MUC1, CAIX, CEA, CD8, CD7, CD10, CD20, CD22, CD30, CLL1, CD33, CD34, CD38, CD41, CD44, CD49f , CD56, CD74, CD133, CD138, EGP-2, EGP40, EpCAM, erb-B2,3,4, FBP, fetal acetylcholine receptor, folate receptor-a, GD2, GD3, HER-2, hTERT, I1L-13R -a2, K light chain, KDR, LeY, L1 cell adhesion molecule, MAGE-A1, Mesothelin, ERBB2, MAGEA3, p53, MART1, GP100, Proteinase3 (PR1), Tyrosinase, Survivina, hTERT, EphA2Z, NKG2D ligands, NY-ESO0-1, oncofetal antigen (h5T4), PSCA, PSMA, ROR1, TAG-72, VEGF-R2, WT-1, BCMA, CD123, CD44V6, NKCS1, EGFIR, EGFR-VIII, and CD99, CD70, ADGRE2 , CCR1, LILRB 2, PRAME, CCRA4, CD5, CD3, TRBC1, TRBC2, TIM-3, Integrin B7, ICAM-1, CD70, Tim3, CLEC12A and ERBB. In certain modalities, said antigen is CD19.
[031] [031] The subject matter currently described further provides a pharmaceutical composition comprising an efficient amount of an immunoresponsive cell described herein, and a pharmaceutically acceptable excipient. In certain embodiments, the pharmaceutical composition is for treating a neoplasm.
[032] [032] The subject in question currently described further provides a method for reducing the tumor burden on a subject, the method comprising administering to the subject an efficient amount of the immunoresponsive cells, or the pharmaceutical composition described herein. The subject matter currently described also provides a method, the method comprising administering to the subject an efficient amount of immunoresponsive cells or a pharmaceutical composition comprising the same, wherein the immunoresponsive cells comprise a chimeric antigenic receptor (CAR) comprising a binding domain of extracellular antigen, a hinge / spacer region, a transmembrane domain, and an intracellular signaling domain comprising a modified CD37 polypeptide, wherein the modified CD36 polypeptide comprises one or more ITAM variants comprising one or more loss-of-function mutations, in which each of the one or more ITAM variations is independently selected from the group consisting of a variation of ITAM1, a variation of ITAM2 and a variation of ITAM3. In certain embodiments, the modified CD37 polypeptide comprises a variation of ITAM2 and a variation of ITAM3. In certain modalities, one or both the ITAM2 variation and the ITAM3 variation comprise two mutations with loss of function. In certain embodiments, the variation of ITAM2 presents the amino acid sequence shown in SEQ ID NO: 29. In certain embodiments, the variation of ITAM3 presents the amino acid sequence shown in SEQ ID NO: 33. In certain embodiments, one or more loss-of-function mutation is at a tyrosine amino acid residue. In certain embodiments, the intracellular signaling domain additionally comprises a co-stimulatory signaling domain. In certain embodiments, the co-stimulatory signaling domain comprises a CD28 polypeptide.
[033] [033] In certain embodiments, the method reduces the number of tumor cells. In certain embodiments, the method reduces the size of the tumor. In certain embodiments, the method eradicates the tumor in the subject.
[034] [034] The subject in question currently described further provides methods for treating or preventing a neoplasm. In certain embodiments, the method comprises administering to the subject an efficient amount of immunoresponsive cells or the pharmaceutical composition described herein. In certain embodiments, the method comprises administering to the subject an efficient amount of immunoresponsive cells or a pharmaceutical composition comprising them, wherein the cell immunoresponsive comprises a chimeric antigen receptor (CAR) comprising an extracellular antigen binding domain, a hinge / spacer region, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, wherein the modified CD36 polypeptide comprises one or more ITAM variations comprising one or more mutations with loss of function, where each one or more ITAM variations is independently selected from the group consisting of a variation of ITAM1, a variation of ITAM2 and a variation of ITAM3.
[035] [035] The subject in question currently described further provides a method for treating a subject with a recurrence of a neoplasm, in which the subject has received an immunoresponsive cell comprising an antigen-recognizing receptor, in which the antigen-recognizing receptor comprises a co signal. - 4-1BB stimulatory. In certain embodiments, the method comprises administering to the subject an efficient amount of the immunoresponsive cells or the pharmaceutical composition described herein. In certain embodiments, the method comprises administering to the subject an efficient amount of immunoresponsive cells or a pharmaceutical composition comprising them, wherein the immunoresponsive cells comprise a chimeric antigen receptor (CAR) comprising an extracellular antigen binding domain, a hinge region. / spacer, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, wherein the modified CD36 polypeptide comprises one or more ITAM variants comprising one or more loss-of-function mutations, each of which one or more variations ITAM is independently selected from the group consisting of a variation of ITAM1, a variation of ITAM2 and a variation of ITAM3. In certain embodiments, the intracellular signaling domain additionally comprises a co-stimulatory signaling domain. In certain embodiments, the co-stimulatory signaling domain comprises a CD28 polypeptide.
[036] [036] In certain modalities, the neoplasm or tumor is selected from the group consisting of blood cancer, B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, non-Hodgkin's lymphoma and ovarian cancer. In certain modalities, the neoplasm is B-cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, or non-Hodgkin's lymphoma, and the CAR binds to CD19. In certain modalities, the neoplasm is CD19 + ALL. In certain embodiments, the neoplasm comprises a tumor cell with a low level of expression of a tumor-specific antigen.
[037] [037] The subject matter currently described further provides a method for producing an antigen-specific immunoresponsive cell, the method comprising introducing into a immunoresponsive cell a nucleic acid sequence encoding a CAR described herein. In certain embodiments, the nucleic acid sequence is comprised of a vector. In certain embodiments, the vector is a retroviral vector.
[038] [038] The subject in question currently described further provides an isolated nucleotide acid encoding the CAR described herein. In certain embodiments, the isolated nucleotide acid further comprises the nucleotide sequence shown in SEQ ID NO: 45 and SEQ ID NO: 47.
[039] [039] The subject matter currently described further provides for a nucleic acid composition comprising a CAR described herein. In certain embodiments, the nucleic acid sequences are comprised in a vector. In certain embodiments, the vector is a retroviral vector.
[040] [040] The subject in question currently described further provides a vector comprising the nucleic acid composition described herein.
[041] [041] The subject in question currently described further provides a kit comprising a CAR, an immunoresponsive cell, a pharmaceutical composition, a nucleic acid composition or a vector described herein. In certain embodiments, the kit additionally comprises written instructions for treating and / or preventing a neoplasm, a pathogen infection, an autoimmune disorder, or an allogeneic transplant. BRIEF DESCRIPTION OF THE DRAWINGS
[042] [042] The following detailed descriptions, provided by way of example, but not intended to limit the subject in question currently described, for the specific modalities described, can be understood together with the attached drawings.
[043] [043] Figure 1 represents cytoplasmic regions of 19287 (19282) wild-type, mutated and truncated CARs. A) Cytoplasmic regions of different CARs 19287 (1928z). Strand 7 of the original CAR 19286 is mutated to construct CAR 19287 T cells with distinct € signaling domains. The three ITAM motifs in the € domain are called ITAM1, ITAM2 and ITAM3 from the proximal membrane to the distal direction. In 1XX, X2X, XX3 and X23 CARs, the two tyrosine residues (Y) in the respective ITAM are mutated in two phenylalanine residues (F) for the indicated ITAMs. In D12 and D23, deletion mutations are performed to remove ITAM1 and ITAM2 (D12) or ITAM2 and ITAM3 (D23). B) 1928z CAR cytoplasmic regions with better antitumor efficiency compared to the original 1928z structure. In 1XX, the € chain of the original 19287 CAR is mutated in a timely manner (conversion of tyrosine (T) to phenylalanine (F)) in ITAM2 and ITAM3, while the rich basic extension (BRS-1, -2, -3) of amino acids remains. In D12 and D23, ITAM1 and ITAM2 (D12) or ITAM2 and ITAM3 (D23) are eliminated; D23 comprises a BRS region (BRS-1), whereas there is no BRS in D12. C) Representative flow cytometry analysis showing levels of CAR and LNGFR expression for 19286 and indicated mutants from 19287. UT: non-transduced T cells were used as controls.
[044] [044] Figures 2A-2B represent therapeutic efficacy of T cells comprising the unprecedented CAR design or CAR 19287 (19282z) control. The therapeutic efficacy of CAR 19287 (19282z) T cells is improved by mutation of the CD3Ç chain in the construction of CAR. The tumor load (medium brightness) of mice bearing NALM-6 treated with 0.05 x 10º T CAR cells (n = 9-10, pooled data from
[045] [045] Figures 3A-3B represent survival after treatment with the same dose of CAR T cells expressing 19287 (19282z) control or unprecedented CAR constructs. Mice with Nalm-6 were treated with T cells CAR * 5x10%. A) and B) Kaplan-Meier analysis of mouse survival, comparing the in vivo efficiency of a single 1928z WT dose and 19287 XX3, X23 and X2X mutants (A) or 1928z D12, D23 and 1XX mutants (B) . Grouped data from 2 independent experiments, representing n = 10 mice. Control refers to untreated mice (n = 3). * p <0.05 (Log-Rank test (Mantel-Cox)).
[046] [046] Figure 4 represents enumeration of T CAR cells in tumor-bearing mice. Mice with NALM-6 were treated with 5 x 10º CAR T cells (n = 10 per group; data grouped from 2 independent experiments) and euthanized on day 17 after infusion; CAR bone marrow T cells and NALM-6 cells were analyzed and counted by FACS. All data are averages + SD. * P <0.05, *** P <0.001, **** P <0.0001 (unpaired Student's T test).
[047] [047] Figures 5A-5C represent T cell differentiation analysis. The CD4 + and CD8 + T cell phenotype in mouse bone marrow 10 days after CAR infusion (data are mediastSEM, each bar represents n = 5 mice) . A) Percentage of CD62L / CD45RA expression in T CAR cells for the indicated 19287 mutants, compared to 19287 WT. B) Percentage of central memory (CD62L + CD45RA-) and C) effector cells (CD62L-CD45RA +) in CD4 + and CD8 + CAR T cells. The data are compared to 19287 WT. ** P <0.01, *** P <0.001 (unpaired Student's t test).
[048] [048] Figure 6 represents analyzes of numbers of CAR memory CD4 + cells of central memory (CAR + CD4 + CD62L + CD45RA-) and CAR CD4 + T cells that express IL7R (data are means + SEM, each bar represents n = 5 mice ) in the bone marrow of mice 10 and 17 days after T cell administration. ** P <0.01, *** P <0.001 (unpaired Student's T test).
[049] [049] Figure 7 represents T cell exhaustion analysis. Mice carrying NALM-6 were treated with 5x10º T CAR cells (n = 92-10 per group; data grouped from 2 independent experiments) and euthanized on day 10 after the infusion of CAR; CAR bone marrow T cells were analyzed by FACS. Percentage of T cells CD4 * and CD8 * expressing exhaustion markers quantified by FACS 10 days after infusion with CAR. Data are averages + SEM, each point represents a mouse. * P <0.05, ** P <0.01, *** P <0.001, (unpaired Student's T test).
[050] [050] Figure 8 represents in vitro functional tests of T CAR cell efficacy. A) Cytotoxic activity as determined by a 5 ° Cr release assay for 4 hours, using EL4-CD19 as targets (n = 2 independent experiments performed in triplicates, data are means + SEM). B) and C) Cytotoxic activity using an 18-hour bioluminescence assay with NALM-6 that express firefly luciferase (FFL) as targets. Data are means + SEM (n = 5 independent experiments carried out in triplicates. The experiments were carried out one week after the expansion of effector cells in irradiated 3T3-CD19.
[051] [051] Figure 9 represents in vitro cytokine profiles of T CAR cells. Percentage of CD4 * and CD8 * T cells with positive expression of single (A) and double positive Th1 cytokines, as determined by intracellular cytokine staining 18 hours after the 2nd stimulation with 3T3-CD19 (data are means + SEM and compared at 19287 WT, paired Student's t test, n = 3-5 independent experiments). * P <0.05, ** P <0.01.
[052] [052] Figure 10 shows a schematic representation of different hinge (H) and transmembrane (TM) domains with 1XX CARs. Flow cytometry profiles show the expression of CAR and LNGFR using IgG fragment
[053] [053] Figure 11 represents cumulative T cell counts through weekly stimulation, starting from 106 cells / mL T cell T cells. Arrows indicate stimulation time points. Data are averages + SEM. n = 3.
[054] [054] Figure 12 represents in vitro cytotoxicity of CAR T cells. Cytotoxic activity of CAR T cells is assessed using a Cr-release assay for 4 hours at the end of the third stimulation (D21). T-cells and EL-4-CD19 + target cells were used in a different Effector: target ratio (E: T). Data are averages + SEM. Data are representative of 4 independent experiments.
[055] [055] Figure 13 represents in vivo antitumor efficacy of different TCAR H / TM cells using NOD.Cg Prkdecscidll2rgtm 1Wil / SzJ (NSG) mice. Upper panel, tumor load is followed by weekly quantification of the bioluminescent signal. CAR construction is indicated for each treatment. Lower panel, Kaplan-Meier analysis of tumor-free survival of mice from the same experiment. The Log-rank test (Mantel-Cox) is used to compare survival. n = 7 mice / group.
[056] [056] Figure 14 represents exemplary de-immunization strategies for unprecedented CAR constructions. J1 and J2: no changes from the WT junction. J3: Replacement of the last amino acid of CD28 Ser (S) with Lys (K). J: Junction; X: point mutation.
[057] [057] Figure 15 represents several survival curves of mice treated with T CAR cells. NSG mice were injected into the caudal vein with x 105 FFLuc-GFP NALMG cells (pre-B ALL cell line), followed by 2x105 CAR 19BBz T cells after four days. Ten days after the 1st T cell injection (an inefficient dose that only slowed the progression of the tumor), the mice were again injected with 19BBz CAR T cells, or alternatively both with 1928z and (5 x 105 / mouse). Arrows indicate infusion time of T cell CAR.
[058] [058] Figures 16A-16E depict that ITAMs 19287 differentially regulate the effectiveness of CAR T cells. A) Cytoplasmic regions of 19287 wild-type and mutated CARs. The CAR 19287 € chain was mutated in one or two of its three signaling domains 6, called ITAM1, ITAM2 and ITAM3, from a membrane-proximal direction to a distal membrane. In 1XX, X2X, XX3 and X23 CARs, the two tyrosines (Y) in the respective ITAM are mutated in two phenylalanines (F) for the indicated ITAMs. B) Flow cytometry analysis showing the levels of expression of CAR and LNGFR for the constructions represented in A). The data are representative of at least five independent experiments with similar results. Non-transduced T cells (UT) were used as the control. C) -E) Mice carrying Nalm6 were treated with 5 x 10º T cells CAR +. C) Tumor load (medium brightness) of mice is shown, comparing the in vivo efficiency of 19286, 1XX, X2X, XX3, and X23 wild type (n = 10 mice per group, results were grouped from two independent experiments). Control refers to untreated mice (n = 6). D) Number of CAR T cells in the bone marrow of mice 17 days after infusion (results were grouped from two independent experiments, n = 10 mice per group). E) CAR T cell phenotype in the bone marrow of mice 10 days after CAR infusion, as demonstrated by the percentage of Tcm and TeFF cells. Representative results from two independent experiments are shown (n = 5 mice per group). All data are averaged s.e.m. In D) and E) P values were determined by two-tailed Mann-Whitney U tests.
[059] [059] Figures 17A-17E depict which position of ITAM in CARs 19287 determines antitumor efficiency. A) 19287 CAR cytoplasmic domains with deletions in the CD37 chain. At D12, elimination mutations remove ITAM1 and
[060] [060] Figures 18A-18H depict that TRAC-1XX increases T cell efficacy by decreasing T cell exhaustion, and developing into long-term memory T cells with efficient recall responses. A) -D), Nalm6-bearing mice were treated with 1x105 or 5x105 TRAC-CAR T cells. A) Kaplan-Meier survival analysis of mice treated with 1x 105 TRAC-1XX or TRAC-XX3, compared with TRAC-19286 (TRAC-19286 and TRAC-XX3: n = 5 mice per group; TRAC-1XX: n = 7 ). Control refers to untreated mice (n = 3). P values were determined by a unilateral Mantel-Cox Log-rank test. B) Kaplan-Meier survival analysis of mice treated with 5x 105 (n = 5 mice per group) or 1x 105 (TRAC-19287: n = 10 mice, TRAC-1XX: n = 5 mice) TRAC-CAR T cells. P values were determined by a unilateral Log-Rank Mantel-Cox test. C) and D) The number of cells (C) and the expression of exhaustion markers PD1 + TIM3 + LAG3 + in bone marrow T CAR cells (D) were determined for TRAC-1XX and TRAC-
[061] [061] Figures 19A-19H depict that CD36 ITAM mutations in € 1928 CARs establish distinct transcriptional signatures. The gene expression profiles of CAR8 CD8 + TRAC-1928 6, TRAC-1XX, and TRAC-XX3 (initially classified T cells) 24 hours after stimulation with CD19 + target cells. A) Normalized enrichment score of significantly or decreasingly regulated gene sets in 1928 Z versus 1XX, and € 1928 versus XX3 (n = 3 replicates per group), as determined by GSEA using the MSigDB gene ontology sets C7. For all pathways, the false discovery rate (FDR) q <0.02. The GSE data sets are indicated in parentheses. stim, stimulated. B) Genes differentially expressed (FDR q <0.05) between classified effector and naive / memory T cells (left) (n = 6 replicates per group) and heat map demonstrating the expression profiles of the same genes for CAR T cells ( n = 3 replicates per group). TF, transcription factor. C) Normalized enrichment score of significantly enriched gene sets (FDR q <0.03), related to T cell phenotypic and functional characteristics, comparing TRAC-1928 £ versus TRAC-XX3, TRAC-1928 £ versus TRAC-1XX, and TRAC-1XX versus TRAC-XX3, in the manner identified with GSEA analysis (n = 3 replicates per group). JAK-STAT, Janus kinase signal transducer and transcription activator. D) Impact of CD3z ITAM mutations defined in T cells € 1928 on T cell characteristics associated with effector and memory. CAR 1XX T cells exhibit balanced effector and memory characteristics.
[062] [062] Figures 20A-20E depict the impact of 19286 CARs with mutated ITAM on T cell function in vitro, T cell differentiation and in vivo antitumor activity. A) Cytotoxic activity as determined by Cr release assay for 4 hours, 1 week after the expansion of effector cells in irradiated 3T3-CD19 (data are shown as means of n = 2 independent experiments performed in triplicates). B) Cumulative cell counts of T CAR cells indicated after weekly stimulation with CD19 + target cells (n = 3 independent experiments). All data are averages + s.e.m. P values were calculated using two-tailed paired Student's t test. C) Nalm6-bearing mice were treated with 5 x 10º CAR + T cells. Kaplan-Meier survival analysis comparing the in vivo efficiency of 19286 wild type or 19287 mutants indicated (n = 10 mice, pooled data from two independent experiments). Control (Ctl) refers to untreated mice (n = 6) The P value was determined by a unilateral Log-Rank Mantel-Cox test. D) CAR T cell phenotype as demonstrated by percentage of CD4 + T CAR cells from central memory (CD62L + CD45RA-) and effector memory (CD62L-CD45RA-) 48 hours after second stimulation with CD19 + target cells. Two-tailed paired Student's t test was performed, the data represent means + s.e.m. of n = 4 independent experiments. E) Mice carrying Nalm6 were treated with 5 x 10º T CAR cells and euthanized on the 10th day after the infusion; CAR bone marrow T cells were analyzed by FACS. Flow cytometry analysis representative of phenotype for indicated T CAR cells, as determined by the expression of CD62L / CD45RA, closed in T cells CAR + CD4 +. Representative of 5 mice per group in at least n = 2 independent experiments with similar results.
[063] [063] Figures 21A-21C represent effector function analysis in 19287 mutants compared to the 19287 wild type. A) Cytotoxic activity of 19287 mutants compared to 19287 wild type, using an 18-hour bioluminescence assay, with NALM6 cells that express FFL as targets. The experiments were carried out 1 week after the expansion of effector cells in CD19 + target cells. Data are averages + s.e.m. (n = 4 independent experiments carried out in triplicates). * P <0.05 (2: P = 0.0273, 2nd: P = 0.0387, 22: P = 0.0125), ** P = 0.0018 as calculated by the two-tailed paired Student's t test, the average of triplicates. B) and C) Expression of granzyme B (GrB) (n = 4 independent experiments) in CAR CD8 + T cells (B), and cytokine secretion (C) of CAR CD4 * and CD8 * cells after 2nd stimulation with target cells that express CD19. All data are averages + s.e.m. (IFNy and IL2, n = 4; TNFa, n = 5 independent experiments). 19287 unstimulated wild-type cells (Unstim.) Were used as controls. Significant differences compared to 19287 were determined by the two-tailed paired Student's t test.
[064] [064] Figures 22A-22D represent localization impact of ITAM in 19287 CARs on T cell function and therapeutic efficacy. A) Cytotoxic activity as determined by Cr release assay for 4 hours 1 week after the expansion of effector cells in irradiated 3T3-CD19 (data are means of n = 2 independent experiments performed in triplicates). B) Cumulative T cell counts indicated after weekly stimulation with CD19 + target cells (n = 3 independent experiments). All data are averages + s.e.m .; P values were calculated with two-tailed paired Student's t test. C) Cytotoxic activity of D12 and D23 compared to 19287 wild type, as determined by 18-hour bioluminescence assay with NALM6 cells that express FFL as targets. The experiments were carried out 1 week after the expansion of effector cells in CD19 + target cells. Data are averages + s.e.m. (n = 4 independent experiments carried out in triplicates). The P value was calculated by the two-tailed paired Student's t test, from the mean of triplicates, and showed no significant difference (P> 0.05) between D12 / D23 and 19287 wild type for all E / T ratios. D) Mice carrying Nalm6 were treated with 5 x 10º T CAR cells. Kaplan-Meier survival analysis of mice treated with 19286 wild type or 19287 mutants indicated (n = 10 mice per group). Control refers to untreated mice (n = 6). The P value was calculated by a unilateral Log-Rank Mantel-Cox test.
[065] [065] Figures 23A-23B represent the influence of the location of ITAM in 19287 CARs on in vitro effector function. A) Expression of granzyme B (GrB) in CD8 + CAR T cells (n = 5 independent experiments). B) Cytokine secretion of CD4 * and CD8 * T cells after second stimulation with target cells that express CD19. 19287 unstimulated wild-type cells were used as controls. All data are mediast s.e.m. (IFNy and IL2, n = 4; TNFa, n = 5 independent experiments). Each individual symbol indicates a sample. Significant differences compared to 19287 were determined by two-tailed paired Student's t test.
[066] [066] Figures 24A-24F represent T cell differentiation and the effector function of 19286 TRAC-encoded mutants. Mice carrying Nalm6 were treated with 1 x 10º T CAR cells and euthanized on day 17 after infusion. The CAR T cells of the bone marrow and spleen were analyzed and counted by FACS. A) Analysis of histogram and flow cytometry of CAR expression 4 days after integration of CAR gene in the TRAC locus. Representative of four independent experiments with similar results. B) CD4 * and CD8 * T cell cells numbers, C) CD8 + Tcm percentage (CD62L + CD45RA-) and flow cytometry analysis of CD62L / CD45RA expression in bone marrow CAR CD8 + T cells (representative of n = 5 mice per group in an independent experiment). D) Ratio of CAR + IL7R + for tumor cells, and analysis of exemplary flow cytometry of T cells IL7R + in the bone marrow of mice. E) Enumeration of T CAR cells in the spleen of mice. In B), C), D) and E) all data are means + s.e.m., two-tailed Mann-Whitney analysis was performed, n = 5 mice per group. F) Cytotoxic activity of TRAC-1XX, TRAC-XX3 and TRAC-19287 wild type (18 hour bioluminescence assay with NALMG6 that expresses FFL as targets). The experiments were carried out 4 days after transduction, 1 week and 3 weeks after expansion with stimuli of CD19 antigen. The symbols show averages of triplicates (a representative donor).
[067] [067] Figures 25A-25G depict T cell exhaustion in vivo of TRAC-19286 mutants compared to wild-type TRAC-19287. A) Mice carrying Nalm6 were treated with 1 x 105 T CAR cells and euthanized on day 17 after the infusion. FACS analysis of expression of exhaustion markers in CAR + T cells, representative of n = 5 mice per group in an independent experiment. B) -G) Mice carrying Nalm6 were treated with 1 x 10 th naive T cells edited by TRAC. 16 (B and C) and 36 (E and G) days after CAR administration, the TRAC-1928 € and TRAC-1XX cells of the bone marrow and spleen were exposed to the stimulus ex vivo with NALM6 or PMA / lonomicina (lono). Expression of cytokine and granzyme B (GrBy / CD107a in T CAR cells, as demonstrated by the percentage of expression and flow cytometry analysis, representative for n = 3 mice in two independent experiments (B), and for n = 3 replicates ( G) Expression of exhaustion markers PD1 + LAG3 + in T cells CAR (D) and cytotoxic activity (F) of TRAC-1XX (day 36) after 10 hours of co-culture with NALM6. All data are averages + sem, n = 3 mice per group.
[068] [068] Figures 26A-26G represent memory T cell formation in
[069] [069] Figures 27A-27C represent transcriptional profiles of 19287 mutants encoded by TRAC and classified control T cells. A) Principal component analysis (PCA) of CD8 + TRAC-1XX global transcriptional profiles,
[070] [070] Figures 28A-28D depict impact of CD36 ITAM mutations in TRAC-19286 on the differentiation state and effector profile of T cell. A) GSEA from a signature of the 200 major genes regulated in increasing fashion on exhausted CD8 T cells, with respect to naive CD8 T cells or memory derived from GSE41867, demonstrating exhaustion signature enrichment in TRAC-19287 versus TRAC-1XX or TRAC-XX3, and in the control classified TerF versus Tn and Tscm. The experiment was carried out in technical triplicates for each CAR construction and in the six replicates for each control subset. B) Analysis of gene ontology showing significantly enriched gene sets associated with inflammation, cytokine and chemokine signaling in 19287 versus XX3, 1XX versus XX3 and 19287 versus 1XX (n = 3). Transcriptional analysis was performed after integration of the CAR gene into the TRAC locus of naive T cells and stimulation with CD19 + target cells. The results are shown in order of significance as —logio (corrected P value). The P values were determined by a one-tailed Fisher exact test, and the Benjamini-Hochberg method was used to correct the multiple hypothesis test. C) Heat map of expressed genes differentially selected among the CAR constructs related to inflammation, cytokine and chemokine activity. D) Flow cytometry analysis of the T cell differentiation state, in CD8 + CAR T cells, after stimulation with CD19 antigen (representative for n = 2 independent experiments with similar results).
[071] [071] Figures 29A-29B represent a blocking strategy to analyze T CAR cells obtained from the bone marrow of treated mice. A) -B) Flow cytometry analysis representative of TRAC-19287 (A) compared to TRAC-1XX (B) on day 17 after infusion with CAR. Blocking positioning was based on FMO controls. DETAILED DESCRIPTION OF THE INVENTION
[072] [072] The subject matter currently described provides new CAR designs comprising a modified CD3Ç chain and cells, including genetically modified immunoresponsive cells (for example, T cells, NK cells or CTL cells) comprising said CARs. The subject matter currently described also provides methods for using such cells to induce and / or improve an immune response to a target antigen, and / or to treat and / or prevent a neoplasm or other diseases / disorders where an increase in an antigen immune response -specific is desired. The subject in question currently described is based, at least in part, on the discovery that immunoresponsive cells comprising a currently described CAR exhibited better therapeutic potency (for example, decreased cell exhaustion), compared to control cells comprising conventional CARs.
[073] [073] Unless otherwise defined, all technical and scientific terms used herein have the meaning commonly understood by those skilled in the art. The following references provide those skilled in the art with a general definition of many of the terms used in the subject in question currently described: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd edition, 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings assigned to them below, unless otherwise specified.
[074] [074] As used herein, the term "about" or "approximately" means, within an acceptable error range for the particular value, in the manner determined by those skilled in the art, which will depend in part on how the value is measured or determined, that is, the limitations of the measurement system. For example, "about" may mean 3 or more than 3 standard deviations, according to practice in the art. Alternatively, "about" can mean a range of up to 20%, for example, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, in particular with respect to biological systems or processes, the term can mean in an order of magnitude, for example, 5 times or 2 times, of a value.
[075] [075] "Activates an immunoresponsive cell" means the induction of signal transduction, or changes in protein expression in the cell that result in the initiation of an immune response. For example, when CD3 chains cluster in response to ligand binding and tyrosine-based immunoreceptor inhibition motifs (ITAMs), a signal cascade transduction is produced. In certain embodiments, when an endogenous TCR or an exogenous CAR binds to an antigen, a formation of an immunological synapse that occurs includes the clustering of many molecules close to the bound receptor (for example, CD4 or CD8, CD3y / 5 / e / 6, etc.). This grouping of membrane-bound signaling molecules allows ITAM motifs contained in the CD3 chains to become phosphorylated. This phosphorylation, in turn, initiates a T cell activation pathway that ultimately activates transcription factors, such as NF- «B and AP-
[076] [076] "Stimulates an immunoresponsive cell" means a signal that results in a strong and continuous immune response. In several embodiments, this occurs after activation of an immune cell (eg, T cell), or is measured concomitantly by means of receptors including, but not limited to, CD28, CD137 (4-IBB), OX40, CD40, CD27, CD40 / My88, NKGD2 and ICOS. The multiple stimulatory signals received can be important for building a long-term, robust T cell-mediated immune response. T cells can quickly become inhibited and unresponsive to the antigen. Although the effects of these co-stimulatory signals may vary, they generally result in increased gene expression in order to generate long-lived, proliferative and anti-apoptotic T cells that respond robustly to the antigen for complete and continuous eradication.
[077] [077] The term "antigen recognition receptor", as used herein, refers to a receptor that is capable of activating an immune or immunoresponsive cell (for example, a T cell) in response to its binding to an antigen. Non-limiting examples of antigen recognition receptors include natural or endogenous T cell receptors ("TCRs"), and chimeric antigenic receptors ("CARS").
[078] [078] As used herein, the term "antibody" means not only intact antibody molecules, but also fragments of antibody molecules that maintain binding capacity to the immunogen. Such fragments are also well known in the art and are regularly used both in vitro and in vivo. Thus, as used herein, the term "antibody" means not only intact immunoglobulin molecules, but also the well-known active fragments F (ab ') 2, and Fab. F (ab') 2, and Fab fragments that lack of the Fc fragment of the intact antibody, eliminated more quickly from the circulation, and may have less nonspecific tissue binding to an intact antibody (Wahl et al., J. Nucl. Med. 24: 316-325 (1983). As used herein , antibodies include complete natural antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab ”, fragments of single chain V region (scFv), fusion polypeptides and unconventional antibodies. In certain embodiments, an antibody is a glycoprotein comprising at least two heavy chains (H) and two light chains (L) interconnected by disulfide bonds. Each heavy chain is comprised of a variable region of heavy chain (here abbreviated as VH), and a constant region of heavy chain (Cx). constant heavy chain is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a variable region of light chain (here abbreviated as V.), and a constant region of light chain Cr. The light chain constant region is comprised of a domain, Cr. The V and V regions can be further subdivided into regions of hypervariability, called complementarity determining regions (CDR), interspersed with regions that are more conserved, called structure regions (FR). Each Vhu and V.1 is composed of three CDRs and four FRs arranged from the amino termination to the carboxy termination in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FRA4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies can mediate the binding of immunoglobulin in tissues or host factors, including various cells of the immune system (for example, effector cells), and the first component (C1 q) of the classical complement system.
[079] [079] As used herein, "CDRs" are defined as the amino acid sequences of the complementary determining region of an antibody, which are the hypervariable regions of heavy and light chains of immunoglobulin. See, for example, Kabat et al., Sequences of Proteins of Immunological Interest, 4th U.S. Department of Health and Human Services, National Institutes of Health (1987). In general, antibodies comprise three heavy chain CDRs and three light chain or CDR regions in the variable region. CDRs provide the majority of contact residues for binding the antibody to the antigen or epitope. In certain embodiments, the CDR regions are outlined using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, publication NIH 91-3242).
[080] [080] As used herein, the term "single chain variable fragment" or "scFv" is a fusion protein from the variable regions of the heavy (Vr) and light (Vl) chains of a covalently linked immunoglobulin to form a VH heterodimer :: V .. The Vx and VL are either directly joined or joined by a linker that encodes peptide (for example, 10, 15, 20, 25 amino acids), which connects the N termination of Vx with the C termination of V1, or the C termination of VH with the N termination of V .. The linker is generally rich in glycine for flexibility, as well as serine or threonine for solubility. Despite the removal of constant regions and the introduction of a linker, scfv proteins retain the specificity of the original immunoglobulin. Single chain Fv polypeptide antibodies can be expressed from a nucleic acid, including sequences encoding VH and V., in the manner described by Huston, et al. (Proc. Nat. Acad. Sci. United States, 85: 5879-5883, 1988). See, also, U.S. patents 5,091,513, 5,132,405 and 4,956,778; and US patent publications 20050196754 and 20050196754. antagonistic scFvs with inhibitory activity have been described (see, for example, Zhao et al., Hyrbidoma (Larchmt) 2008 27 (6): 455-51; Peter et al., J Cachexia Sarcopenia Muscle August 12, 2012; Shieh et al., J Imunol / 2009 183 (4): 2277-85; Giomarelli et al., Thromb Haemost 2007 97 (6): 955-63; Fife eta., J Clin Invst 2006 116 (8): 2252-61; Brocks et al., Immunotechnology 1997 3 (3): 173-84; Moosmayer et al., Ther Immunol 1995 2 (10: 31-40). Agonist scFvs with stimulatory activity have been described (see , for example, Peter et al., J Bioi Chern 2003 25278 (38): 36740-7; Xie et al., Nat Biotech 1997 15 (8): 768-71; Ledbetter et al., Crit Rev Immunol1997 17 (5 -6): 427-55; Ho et al, BioChim Biophys Acta 2003 1638 (3): 257-66).
[081] [081] As used herein, the term "affinity" means a measure of binding strength. Affinity may depend on the proximity of stereochemical adjustment between antibody combining sites and antigen determinants, the size of the contact area between them, and / or the distribution of charged and hydrophobic groups. As used herein, the term "affinity" also includes "avidity", which refers to the strength of the antigen-antibody bond after the formation of reversible complexes. Methods for calculating the affinity of an antibody for an antigen are known in the art including, but not limited to, various antigen binding experiments, for example, functional assays (for example, flow cytometry assay).
[082] [082] The term "chimeric antigenic receptor" or "CAR", as used herein, refers to a molecule comprising an extracellular antigen binding domain, which is fused to an intracellular signaling domain that is capable of activating or stimulating an immunoresponsive cell, and a transmembrane domain. In certain embodiments, the extracellular antigen binding domain of a CAR comprises an scFv. ScFv can be derived from the fusion of the heavy and light variable regions of an antibody. Alternatively, or in addition, scFv can be derived from Fab's (instead of starting from an antibody, for example, obtained from Fab libraries). In certain embodiments, scFv is fused to the transmembrane domain and then to the intracellular signaling domain. In certain modalities, the CAR is selected to have high binding affinity or avidity for the antigen.
[083] [083] As used herein, the term "nucleic acid molecules" includes any nucleic acid molecule that encodes a polypeptide of interest or a fragment thereof. Such nucleic acid molecules need not be 100% homologous or identical to an endogenous nucleic acid sequence, but they can exhibit substantial identity. Polynucleotides with "substantial identity" or "substantial homology" to an endogenous sequence are typically capable of hybridizing to at least one strand of a double stranded nucleic acid molecule. "Hybridize" means a pair to form a double-stranded molecule between sequences of complementary polynucleotides (for example, a gene described herein), or portions thereof, under various conditions of severity. (See, for example, Wahl, G. M.eS. L. Berger (1987) Methods Enzymol. 152: 399; Kimmel, A. R. (1987) Methods Enzymol. 152: 507).
[084] [084] For example, severe salt concentration will commonly be less than about 750 mM NaCl and 75 mM trisodium citrate, for example, less than about 500 mM NaCl and 50 MM trisodium citrate, or less than about NaCl 250 mM and 25 mM trisodium citrate. Low severity hybridization can be achieved in the absence of organic solvent, for example formamide, while high severity hybridization can be obtained in the presence of at least about 35% formamide, for example, at least about 50% formamide. Severe temperature conditions will commonly include temperatures of at least about 30 ° C, at least about 37 ° C, or at least about 42 ° C. Additional variation parameters, such as hybridization time, the concentration of detergent, for example, sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art. Various levels of severity are achieved by combining these various conditions if necessary. In certain modalities, hybridization will occur at 30 ºC in 750 mM NaCl, 75 MM trisodium citrate, and 1% SDS. In certain embodiments, hybridization will take place at 37 ºC in 500 mM NaCl, 50 MM trisodium citrate, 1% SDS, 35% formamide, and 100 µg / mL denatured salmon sperm DNA (DNAss). In certain modalities, hybridization will occur at 42 ºC in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide and 200 ug / mL of DNAss. The variations used in these conditions will be easily evident to those skilled in the art.
[085] [085] For most applications, the washing steps that follow hybridization will also vary in severity. The washing severity conditions can be defined by salt concentration and temperature. In the foregoing, the severity of the wash can be increased by lowering the salt concentration or by increasing the temperature. For example, the severe salt concentration for the washing steps may be less than about 30 mM NaCl and 3 mM trisodium citrate, for example, less than about 15 mM NaCl and 1.5 mM trisodium citrate. Severe temperature conditions for the washing steps will commonly include a temperature of at least about 25 ° C, at least about 42 ° C, or at least about 68 ° C. In certain embodiments, the washing steps will take place at 25 ºC in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In certain embodiments, the washing steps will take place at 42 ºC in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In certain embodiments, the washing steps will take place at 68 ºC in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
[086] [086] "Substantially identical" or "substantially homologous" means a polypeptide or nucleic acid molecule that exhibits at least about 50% homology or is identical to an amino acid sequence (for example, any of the amino acid sequences described herein) or reference nucleic acid sequence (for example, any of the nucleic acid sequences described herein). In certain embodiments, a sequence like this is at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85% at least about 90%, at least about 95%, at least about 99%, or at least about 100% homologous or identical to the sequence of the amino acid or nucleic acid used for comparison.
[087] [087] Sequence identity can be evaluated using sequence analysis software (eg, Genetics Computer Group sequence analysis software package, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST programs , BESTFIT, GAP or PILEUP / PRETTYBOX). Such software combines identical or similar sequences assigning degrees of homology to various substitutions, deletions and / or other modifications. Conservative substitutions typically include substitutions in the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program can be used, with a probability score between e-3 and € -100, indicating a closely related sequence.
[088] [088] "Analog" means a polypeptide or nucleic acid molecule structurally related to the function of a reference polypeptide or nucleic acid molecule.
[089] [089] The term "ligand", as used herein, refers to a molecule that binds to a receptor. In certain embodiments, the ligand binds to a receptor in another cell, allowing for cell-to-cell recognition and / or interaction.
[090] [090] The term "constitutive expression" or "constitutively expressed", as used herein, refers to expression or expressed in all physiological conditions.
[091] [091] "Illness" means any condition, disease or disorder that impairs or interferes with the normal function of a cell, tissue or organ, for example, neoplasia, and infection by the cell's pathogen.
[092] [092] "Efficient amount" means an amount sufficient to have a therapeutic effect. In certain embodiments, an "efficient amount" is an amount sufficient to stop, improve or inhibit the continued proliferation, growth or metastasis (for example, invasion or migration) of a neoplasm.
[093] [093] "Execution tolerance" means preventing the activity of autoreactive cells or immunoresponsive cells that target transplanted organs or tissues.
[094] [094] "Endogenous" means a molecule of nucleic acid or polypeptide that is normally expressed in a cell or tissue.
[095] [095] "Exogenous" means a nucleic acid molecule or polypeptide that is not endogenously present in a cell. The term "exogenous", therefore, can include any recombinant nucleic acid molecule or polypeptide expressed in a cell, such as heterologous and positively expressed nucleic acid molecules and external polypeptides. "Exogenous" nucleic acid means a nucleic acid that is not present in a natural wild-type cell; for example, an exogenous nucleic acid can vary from an endogenous counterpart by sequence, by position / location, or both. For clarification, an exogenous nucleic acid can have the same or different sequence in relation to its natural endogenous counterpart; it can be introduced by genetic modification into the cell itself or a parent of the cell, and can optionally be linked to alternative control sequences, such as an unnatural promoter or secretory sequence.
[096] [096] "Heterologous nucleic acid molecule or polypeptide" means a nucleic acid molecule (for example, a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell. This nucleic acid can be from another organism, or it can be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
[097] [097] "Immune responsive cell" means a cell that functions in an immune response or a parent, or progeny thereof.
[098] [098] “Modular” means to change positively or negatively. Exemplary modulations include a change of about 1%, about 2%, about 5%, about 10%, about 25%, about 50%, about 75% or about 100%.
[099] [099] "Increase" means to change positively by at least about 5%. A change can be about 5%, about 10%, about 25%, about 30%, about 50%, about 75%, about 100% or more.
[0100] [0100] "Reduce" means to change negatively by at least about 5%. A change can be about 5%, about 10%, about 25%, about 30%, about 50%, about 75%, or about 100%.
[0101] [0101] "Isolated cell" means a cell that is separated from the molecular and / or cellular components that naturally accompany the cell.
[0102] [0102] The terms "isolated", "purified" or "biologically pure" refer to material that is free in varying degrees of components that normally accompany it, as observed in its natural state. "Isolate"
[0103] [0103] The term "antigen binding domain", as used herein, refers to a domain capable of specifically binding to a particular antigenic determinant or set of antigenic determinants present in a cell.
[0104] [0104] "Linker", as used herein, may mean a functional group (for example, chemical or polypeptide) that covalently attaches two or more polypeptides or nucleic acids, so that they are connected to each other. As used herein, a "peptide linker" refers to one or more amino acids used to couple two proteins together (for example, to couple the VnH and V. domains). In certain embodiments, the linker comprises a sequence shown in GGGGSCGGGGSGCGGGGS [SEQ ID NO: 66].
[0105] [0105] "Neoplasm" means a disease characterized by the pathological proliferation of a cell or tissue, and its subsequent migration or invasion of other tissues or organs. The growth of the neoplasm is typically uncontrolled and progressive, and occurs in conditions that would not cause, or would not cause, the multiplication of normal cells to cease. The neoplasm can affect a variety of cell types, tissues or organs including, but not limited to, an organ selected from the group consisting of bladder, bones, brain, breast, cartilage, glia, esophagus, fallopian tube, gallbladder, heart, intestines, kidney, liver, lung, lymph node, nervous tissue, ovaries, pancreas, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testicles, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus and vagina, or a tissue or cell type thereof. Neoplasms include cancers, such as sarcomas, carcinomas or plasmacytomas (malignant tumor of plasma cells).
[0106] [0106] "Receptor" means a polypeptide, or portion thereof, present in a cell membrane that selectively binds one or more ligands.
[0107] [0107] “Recognize” means to selectively bind to a target. A T cell that recognizes a tumor can express a receptor (for example, a TCR or CAR) that binds to a tumor antigen.
[0108] [0108] "Reference" or "control" means a standard of comparison. For example, the level of scFv-antigen binding by a cell that expresses a CAR and a scFv can be compared to the level of scFv-antigen binding in a corresponding cell that expresses CAR alone.
[0109] [0109] "Secreted" means a polypeptide that is released from a cell via the secretory pathway through the endoplasmic reticulum, Golgi complex, and as a vesicle that transiently fuses into the cell's plasma membrane, releasing proteins outside the cell.
[0110] [0110] "Signal sequence" or "leader sequence" means a peptide sequence (for example, 5, 10, 15, 20, 25 or 30 amino acids), present in the N-terminus of newly synthesized proteins, which directs its entry into the pathway secretory. Exemplary leader sequences include, but are not limited to, the IL-2 signal sequence: MYRMOQLLSCIALSLALVTNS [SEQ ID NO: 67] (human), MYSMQLASCVTLTLVLLVNS [SEQ ID NO: 68] (mouse); the kappa leader string: - “METPAQLLFLLLLWLPDTTG [SEQ ID NO 669) (human),
[0111] [0111] "Binds specifically" means a polypeptide or fragment thereof that recognizes and binds to a biological molecule of interest (for example, a polypeptide), but which does not substantially recognize and bind to other molecules in a sample, for example example, a biological sample, which naturally includes a currently described polypeptide.
[0112] [0112] The term "tumor antigen", as used herein, refers to an antigen (for example, a polypeptide) that is uniquely or differentially expressed in a tumor cell, compared to a normal or non-IS neoplastic cell. In certain embodiments, a tumor antigen includes any polypeptide expressed by a tumor that is capable of activating or inducing an immune response through a CAR (for example, CD19, MUC-16), or capable of suppressing an immune response through of the receptor-ligand link (for example, CD47, PD-L1 / L2, B7.1 / 2).
[0113] [0113] The terms "comprises", "comprising" are intended to present the broad meaning given to them in United States patent law and can mean "include", "including" and the like.
[0114] [0114] As used herein, "treatment" refers to clinical intervention in an attempt to alter the course of the disease of the individual or cell being treated, and can be performed both for prophylaxis and during the course of clinical pathology. The therapeutic effects of treatment include, without limitation, preventing the occurrence or recurrence of disease, relieving symptoms, decreasing any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, improving or palliating the condition disease, and remission or improved prognosis. By preventing the progression of a disease or disorder, a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject, or a suspect subject with the disorder, but a treatment can also prevent the onset of the disorder or a symptom of the disorder. in a subject at risk for the disorder or suspected of having the disorder.
[0115] [0115] An "individual" or "subject" here is a vertebrate, such as a human or non-human animal, for example, a mammal. Mammals include, but are not limited to, humans, primates, farm animals, sport animals, rodents and pets. Non-limiting examples of non-human animal subjects include rodents, such as mice, rats, hamsters and guinea pigs; rabbits; dogs; cats; sheep; pigs; goats; cattle; horses; and non-human primates such as apes and monkeys. The term "immunocompromised", as used herein, refers to a subject who has an immunodeficiency. The subject is very vulnerable to opportunistic infections, infections caused by organisms that generally do not cause disease in a person with a healthy immune system, but can affect people with a malfunctioning or suppressed immune system.
[0116] [0116] Other aspects of the subject in question currently described are described in the description below, are within the scope of the subject in question currently described.
[0117] [0117] The present description provides chimeric antigenic receptors (CARs) that bind to an antigen of interest. CAR can bind to a tumor antigen or a pathogen antigen.
[0118] [0118] In certain modalities, the CAR binds to a tumor antigen. Any tumor antigen (antigenic peptide) can be used in the tumor-related modalities described here. Antigen sources include, but are not limited to, cancer proteins. The antigen can be expressed as a peptide or as an intact protein or portion thereof. The intact protein or a portion of it can be natural or mutated. Non-limiting examples of tumor antigens include carbonic anhydrase IX (CAIX), carcinoembryonic antigen (CEA), CD8, CD7, CD10, CD19, CD20, CD22, CD30, CD33, CLL1, CD34, CD38, CD41, CD44, CD49f, CD56 , CD74, CD133, CD138, CD123, CD44V6, a cytomegalovirus (CMV) -infected cell antigen (for example, a cell surface antigen), epithelial glycoprotein-2 (EGP-2), epithelial-40 glycoprotein (EGP40 ), epithelial cell adhesion molecule (EDPCAM), protein receptor tyrosine kinase erb-B2,3,4 (erb-B2,3,4), folate-binding protein (FBP), fetal acetylcholine receptor (ACIR) , folate receptor-a, Ganglioside G2 (GD2), Ganglioside G3 (GD3), human epidermal growth factor receptor 2 (HER-2), human telomerase reverse transcriptase (hTERT), interleukin-receptor alpha-2 subunit 13 (IL-13Ra2), K- light chain, kinase insertion domain receptor (KDR), Lewis Y (LeY), L1 cell adhesion molecule (L1ICAM), family A of the antigen d and melanoma, 1 (MAGE-A1), Mucine 16 (MUC16), Mucine 1 (MUC1), Mesothelin (MSLN), ERBB2, MAGEA3, p53, MART1, GP100, Proteinase3 (PR1), Tyrosinase, Survivin, hTERT, EphA 2, NKG2D ligands, NY-ES0-1 testicular cancer antigen, oncofetal antigen (h5T4), prostate stem cell antigen (PSCA), prostate specific membrane antigen (PSMA), ROR1, tumor-associated glycoprotein 72 ( TAG-72), vascular endothelial growth factor R2 (VEGF-R2), and Wilms tumor protein (WT-1), BCMA, NKCS1, EGFIR, EGFR-VIII, CD99, CD70, ADGRE2, CCR1, LILRB2, PRAME CCRA4, CD5, CD3, TRBC1, TRBC2, TIM-3, Integrin B7, ICAM-1, CD70, Tim3, CLEC12A and ERBB.
[0119] [0119] In certain embodiments, the CAR binds to a CD19 polypeptide. In certain embodiments, CAR binds to a human CD19 polypeptide. In certain embodiments, the human CD19 polypeptide comprises the amino acid sequence shown in SEQ ID NO: 75. PEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGL PGLGIHMRPLAIWLFIFNVYSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFR WNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPR DSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKD
[0120] [0120] In certain modalities, CAR binds to the extracellular domain of a CD19 protein.
[0121] [0121] In certain modalities, CAR binds to a pathogen antigen, for example, for use in the treatment and / or prevention of a pathogen infection or other infectious diseases, for example, in an immunocompromised subject. Non-limiting examples of the pathogen include a virus, bacteria, fungi, parasites and protozoa capable of causing disease.
[0122] [0122] Non-limiting examples of viruses include, Retroviridae (for example, human immunodeficiency virus, such as HIV-1 (also referred to as HDTV-IIl, LAVE or HTLV-II / LAV, or HIV-III; and other isolates, such as HIV-LP; Picornaviridae (for example, polio virus, hepatitis A virus; enterovirus, human Coxsackie virus, rhinovirus, ecovirus); Calciviridae (for example, strains that cause gastroenteritis); Togaviridae (for example, equine encephalitis virus , rubella virus); Flaviridae (for example, dengue virus, encephalitis virus, yellow fever virus); Coronoviridae (for example, coronavirus); Rhabdoviridae (for example, vesicular stomatitis virus, rabies virus); Filoviridae ( e.g. Ebola virus); Paramyxoviridae (e.g. parainfluenza virus, mumps virus, measles virus, respiratory syncytial virus); Orthomyxoviridae (e.g. influenza virus); Bungaviridae (e.g. Hantaan virus, bunga virus, phlebovirus and Naira virus); Arena viridae (vir hemorrhagic fever); Reoviridae (for example, reovirus, orbivirus and rotavirus); Birnaviridae; Hepadnaviridae (Hepatitis B virus); Parvoviride (parvovirus); Papovaviridae (papilloma virus, polyoma virus); Adenoviridae (mainly adenovirus); Herpesviridae (herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), herpes virus; Poxviridae (smallpox virus, vaccinia virus, pox virus); and Iridoviridae (for example, African swine fever virus); and unclassified viruses (eg, the hepatitis delta agent (it is believed to be an imperfect hepatitis B virus satellite), non-A, non-B hepatitis agents (class 1 = transmitted internally; class 2 = transmitted parenterally (i.e., hepatitis C); Norwalk and related viruses, and astroviruses).
[0123] [0123] Non-limiting examples of bacteria include species of Pasteurella, Staphylococci, Streptococcus, Escherichia coli Pseudomonas, and Salmonella species. Specific examples of infectious bacteria include, but are not limited to, Helicobacter pyloris, Borelia burgdorferi, Legionella pneumophilia, Mycobacteria sps (for example, M. tuberculosis, M. avium, M. intracellulare, M. kansaii, M. gordonae), Staphylococcus aureus, Neisseria gonorrhoeae, Neisseria meningitidis, Listeria monocytogenes, Streptococcus pyogenes (Streptococcus group A), Streptococcus agalactiae (Streptococcus group B), Streptococcus (viridans group), Streptococcus faecalis (Streptococcus faecalis, streptococcus faecalis, , —Campylobacter sp. pathogenic, Enterococcus sp., Haemophilus influenzae, Bacillus antracis, corynebacterium diphtheriae, —corynebacterium sp., Erysipelothricz rhusiopathiae, Clostridium perfringers, Clostridium tetani, Enterobacter aerogenes, Klebsiella pneumonia, Stressurella pneumonia, , Treponema pertenue, Leptospira, Rickettsia and Actinomyces israelli.
[0124] [0124] In certain embodiments, the pathogen antigen is a viral antigen present in cytomegalovirus (CMV), a viral antigen present in Epstein Barr virus (EBV), a viral antigen present in the human immunodeficiency virus (HIV), or an antigen virus present in the influenza virus.
[0125] [0125] CARs are genetically modified receptors that engraft or confer a specificity of interest in an immune effector cell. CARs can be used to graft the specificity of a monoclonal antibody into a T cell; with transfer of its coding sequence facilitated by retroviral vectors.
[0126] [0126] There are three generations of CARs. "First generation" CARs are typically composed of an extracellular antigen binding domain (e.g., a scFv), which is fused to a transmembrane domain, which is fused to the cytoplasmic / intracellular signaling domain. “First generation” CARs can again provide antigen recognition and cause activation of both CD4 * and CD8 * T cells through their CD37 chain signaling domain in a single fusion molecule, regardless of HLA-mediated antigen presentation . "Second generation" CARs add intracellular signaling domains of various costimulatory molecules (eg, CD28, 4-1BB, ICOS, OX40, CD27, CD40 / My88 and NKGD2) to the cytoplasmic tail of the CAR to provide additional signals for the T. cell “second generation” CARs comprise those that provide both co-stimulation (for example, CD28 or 4-1BB) and activation (CD37). “Third generation” CARs include those that provide multiple co-stimulation (for example, CD28 and 4-1BB) and activation (CD36). In certain modalities, the CAR is a second generation CAR. In certain embodiments, the CAR comprises an extracellular antigen binding domain that binds to an antigen, a transmembrane domain and an intracellular signaling domain, wherein the intracellular signaling domain comprises a co-stimulatory signaling domain. In certain embodiments, the CAR additionally comprises a hinge / spacer region.
[0127] [0127] In certain non-limiting modalities, the extracellular antigen binding domain of the CAR (incorporated, for example, into a scFv or its analog) binds to an antigen with a dissociation constant (Ka) of about 2 x 107 M or less. In certain embodiments, the Ka is about 2 x 10 M or less, about 1 x 10 "M or less, about 9 x 10 M or less, about 1 x 108 M or less, about 9 x 10 M or less, about 5 x 10º M or less, about 4 x 10º M or less, about 3 x 10º or less, about 2 x 10º M or less, or about 1 x 10º M or less. non-limiting modalities, Ka is about 3 x 10º M or less. In certain non-limiting modalities, Ka is from 1 x 10º M to about 3 x 107 M. In certain non-limiting modalities, Ka is about 1.5 x 10º M to about 3 x 107 M. In certain non-limiting modalities, the Ka is from 1.5 to 10º M to about 2.7 x 107 M. In certain non-limiting modalities, the Ka is about 1 x 10º M to about 1 x 10º M. In certain non-limiting modalities, the Ka is about 1x 10 M to about 1 x 10º M.
[0128] [0128] The binding of the extracellular antigen binding domain (for example, in a scFv or an analog thereof) can be confirmed, for example, by the enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (for example, growth inhibition), or Western Blot assay. Each of these assays generally detects the presence of protein-antibody complexes of particular interest, employing a labeled reagent (for example, an antibody, or scFv) specific to the complex of interest. For example, scFv can be radioactively labeled and used in a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course in Radioligand Assay Techniques, The Endocrine Society, March, 1986, which is incorporated by reference). The radioactive isotope can be detected by such means as using a y counter, or a scintillation counter or by autoradiography. In certain embodiments, the extracellular antigen binding domain of the CAR is labeled with a fluorescent marker. Non-limiting examples of fluorescent labels include green fluorescent protein (GFP), blue fluorescent protein (for example, EBFP, EBFP2, Azurite, and mKalama1), cyan fluorescent protein (for example, ECFP, Cerulean, and CyPet) and yellow fluorescent protein ( for example, YFP, Citrine, Venus, and YPet).
[0129] [0129] In certain embodiments, the extracellular antigen binding domain specifically binds to an antigen. In certain embodiments, the extracellular antigen binding domain is an scFv. In certain embodiments, scFv is a human scFv. In certain embodiments, scFfv is a humanized scFv. In certain embodiments, scFv is murine scFv. In certain embodiments, the extracellular antigen binding domain is a Fab, which is optionally cross-linked. In certain embodiments, the extracellular antigen binding domain is an F (ab) 2. In certain embodiments, any of the foregoing molecules can be comprised of a fusion protein with a heterologous sequence to form the extracellular antigen binding domain. In certain embodiments, scFv is identified by screening the scFv phage library with an antigen-Fc fusion protein. ScFv can be derived from a mouse that carries human VL and / or VH genes. ScFv can also be replaced by a heavy chain of camelid (for example, VHH, camel, llama, etc.), or a partial natural ligand for a cell surface receptor. In certain embodiments, the antigen is a tumor antigen, for example, one described herein. In certain embodiments, the antigen is a pathogen antigen, for example, one described here.
[0130] [0130] In certain embodiments, the extracellular antigen binding domain is a murine scFv. In certain embodiments, the extracellular antigen binding domain is a murine scFv that binds to a human CD19 polypeptide. In certain embodiments, the extracellular antigen binding domain is a murine scFv, which comprises the amino acid sequence of SEQ ID NO: 84 and specifically binds to a human CD19 polypeptide (for example, a human CD19 polypeptide comprising the sequence of amino acid shown in SEQ ID NO: 75). In certain embodiments, the nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 84 is shown in SEQ ID NO: 85. In certain embodiments, murine scFv comprises a heavy chain variable region (VH) comprising the sequence amino acid shown in SEQ ID NO: 82. In certain embodiments, murine scFv comprises a light chain variable region (VL) comprising the amino acid sequence shown in SEQ ID NO:
[0131] [0131] As used herein, the term "a conservative sequence modification" refers to an amino acid modification that does not significantly affect or alter the binding characteristics of the CAR currently described (for example, the extracellular antigen binding domain of the CAR) comprising the amino acid sequence. Conservative modifications may include amino acid substitutions, additions and deletions. The modifications can be introduced into the human scFv of the CAR currently described by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Amino acids can be classified into groups according to their physicochemical properties, such as charge and polarity. Conservative amino acid substitutions are those in which the amino acid residue is replaced by an amino acid in the same group. For example, amino acids can be classified by charge: positively charged amino acids include lysine, arginine, histidine, negatively charged amino acids include aspartic acid, glutamic acid, neutrally charged acids include alanine, asparagine, cysteine, glutamine, glycine, isoleucine, leucine, methionine , phenylalanine, proline, serine, threonine, tryptophan, tyrosine and valine. In addition, amino acids can be classified by polarity: polar amino acids include arginine (basic polar), asparagine, aspartic acid (polar acidic), glutamic acid (polar acidic), glutamine, histidine (basic polar), lysine (basic polar), serine , threonine and tyrosine; Non-polar amino acids include alanine, cysteine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan and valine. Thus, one or more amino acid residues in a CDR region can be replaced by other amino acid residues from the same group, and the altered antibody can be tested for maintained function (that is, the functions shown in (c) a (|) above), using the functional tests described here. In certain modalities, not more than one, not more than two, not more than three, not more than four, not more than five residues in a specified sequence or CDR region are altered.
[0132] [0132] The amino acid sequences Vmx and / or VL with at least about 80%, at least about 80%, at least about 85%, at least about 90%, or at least about 95% (for example, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90 %, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99%) of homology or identity to a specific sequence (for example, SEQ ID NOs: 82 and 83) may contain substitutions (for example, conservative substitutions), insertions, or deletions with respect to the specified sequence (s), but retain the ability to bind to a target antigen (for example, CD19). In certain embodiments, a total of 1 to 10 amino acids are substituted, inserted and / or eliminated in a specific sequence (for example, SEQ ID NOs: 82, and 83). In certain embodiments, substitutions, insertions, or deletions occur in regions outside the CDRs (for example, in the FRs) of the extracellular antigen binding domain. In certain embodiments, the extracellular antigen binding domain comprises Vn and / or VL sequence selected from the group consisting of SEQ ID NOs: 82, and 83, including post-translational modifications of this sequence (SEQ ID NO: 82 and 83).
[0133] [0133] As used here, the percent homology between two amino acid sequences is equivalent to the percent identity between the two sequences. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (that is,% homology = number of identical positions / total number of positions x 100), taking into account the number of intervals and the size of each interval that needs to be entered for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be performed using a mathematical algorithm.
[0134] [0134] The percentage homology between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4: 11-17 (1988)) that was incorporated in the ALIGN program (version 2.0), using a PAM120 weight residual table, an interval size penalty of 12 and an interval penalty of 4. In addition, the percentage homology between two amino acid sequences can be determined using the Needleman and Wunsch algorithm ( J. Mol. Biol. 48: 444-453 (1970)), which was incorporated into the GAP program, in the GCG software package (available at www.gcg.com), using both a Blossum 62 matrix and a PAM250 matrix, and a weight in the range of 16, 14, 12, 10.8, 6 or 4 and a size-weight of 1.2, 3.4.5 or 6.
[0135] [0135] Additionally, or alternatively, the amino acid sequences of the subject in question currently described can be used additionally as a "query string" to conduct a search against public databases, for example, to identify related sequences. Such searches can be performed using the XBLAST program (version 2.0) by Altschul, et al. (1990) J. Mol. Biol. 215: 403-10. BLAST protein searches can be performed with the XBLAST program, punctuation = 50, word size = 3 to obtain amino acid sequences homologous to the specified sequences (for example, scFv m903, m904, heavy and light chain variable region sequences, m905, m906, and m900) described herein. To obtain interval alignments for comparison purposes, Gapped BLAST can be used in the manner described in Altschul et al., (1997) Nucleic Acids Res. 25 (17): 3389-3402. When using the BLAST and Gapped BLAST programs, the standard parameters of the respective programs (for example, XBLAST and NBLAST) can be used.
[0136] [0136] In certain non-limiting embodiments, the transmembrane domain of the CAR comprises a hydrophobic alpha helix that crosses at least a portion of the membrane. Different transmembrane domains result in different receptor stabilities. After antigen recognition, the grouping of receptors and a signal are transmitted to the cell. According to the subject matter currently described, the transmembrane domain of the CAR may comprise a natural or modified transmembrane domain of a CD8 polypeptide, a CD28 polypeptide, a CD37 polypeptide, a CD40 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, a CD84 polypeptide, a CD166 polypeptide, a CD8a polypeptide, a CD8b polypeptide, an ICOS polypeptide, an ICAM-1 polypeptide, a CTLA-H4 polypeptide, a CD27 polypeptide, a CD40 / My88 polypeptide, an NKGD 2 polypeptide synthetic (which is not based on a protein associated with the immune response), or a combination of them. CD8
[0137] [0137] In certain embodiments, the transmembrane domain comprises a CD8 polypeptide. In certain embodiments, the CD8 polypeptide comprises or has an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96% at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 001139345.1 (SEQ ID NO: 86) ( the homology here can be determined using standard software, such as BLAST or FASTA) as provided below, or a fragment thereof, and / or optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain embodiments, the CD8 polypeptide comprises or presents an amino acid sequence that is a consecutive portion of SEQ ID NO: 86, which has at least 20, or at least 30, or at least 40, or at least 50, and up to 235 amino acids in size. Alternatively or additionally, in various non-limiting modalities, the CD8 polypeptide comprises or presents an amino acid sequence of amino acids 1 to 235, 1 to 50, 50 to 100, 100 to 150, 150 to 200, or 200 to 235 of SEQ ID NO : 86. In certain embodiments, the CAR currently described comprises a transmembrane domain comprising a CD8 polypeptide, which comprises or has an amino acid sequence of amino acids 137 to 209 of SEQ ID NO: 86. MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNP TSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTARFSGKRLGDTFVLTLSDFR RENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEAC
[0138] [0138] In certain embodiments, the CD8 polypeptide comprises or has an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: ANA92533.1 (SEQ ID NO : 87) (the homology here can be determined using standard software such as BLAST or FASTA) as provided below, or a fragment thereof, and / or optionally comprise up to one, or even two or even three, conservative amino acid substitutions. In certain embodiments, the CD8 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 87 that has at least about 20, or at least about 30, or at least about 40, or at least about 50, or at least about 60, or at least about 70, or at least about 100, or at least about 200, and up to 247 amino acids in size. Alternatively, or in addition, in various non-limiting modalities, the CD8 polypeptide comprises or presents an amino acid sequence of amino acids 1 to 247, 1 to 50, 50 to 100, 100 to 150, 150 to 200, 151 to 219, or 200 to 247 of SEQ ID NO: 87. In certain embodiments, the CAR currently described comprises a transmembrane domain comprising a CD8 polypeptide, which comprises or has an amino acid sequence of amino acids 151 to 219 of SEQ ID NO: 87.
[0139] [0139] In certain embodiments, the CD8 polypeptide comprises or presents the amino acid sequence shown in SEQ ID NO: 88, which is provided as follows:
[0140] [0140] According to the subject in question currently described, a "CD8 nucleic acid molecule" refers to a polynucleotide that encodes a CD8 polypeptide.
[0141] [0141] In certain embodiments, the CD8 nucleic acid molecule encoding the CD8 polypeptide with the amino acid sequence shown in SEQ ID NO: 88 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 89, in the manner provided for follow. TCTACTACTACCAAGCCAGTGCTGCGAACTCCCTCACCTGTGCACCC TACCGGGACATCTCAGCCCCAGAGACCAGAAGATTGTCGGCCCCGTGGCTCAG TGAAGGGGACCGGATTGGACTTCGCCTGTGATATTTACATCTGGGCACCCTTGG
[0142] [0142] In certain embodiments, the currently described transmembrane domain of a CAR comprises a CD28 polypeptide. The CD28 polypeptide can have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: P10747 or NP 006130 (SEQ ID NO: 90), or fragment of same, and / or optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the CD28 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 90, which has at least 20, or at least 30, or at least 40, or at least 50 and even 220 amino acids in size. Alternatively, or in addition, in various non-limiting modalities, the CD28 polypeptide comprises or presents an amino acid sequence of amino acids 1 to 220, 1 to 50, 50 to 100, 100 to 150, 114 to 220, 150 to 200, or 200 to 220 of SEQ ID NO: 90. In certain embodiments, the CD28 polypeptide comprised in the transmembrane domain of a currently described CAR comprises or has an amino acid sequence of amino acids 153 to 179 of SEQ ID NO: 90.
[0143] [0143] SEQ ID NO: 90 is provided below:
[0144] [0144] According to the subject in question currently described, a "CD28 nucleic acid molecule" refers to a polynucleotide that encodes a CD28 polypeptide. In certain embodiments, the CD28 nucleic acid molecule encoding the CD28 polypeptide with amino acids 153 to 179 of SEQ ID NO: 90 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 91, as provided below.
[0145] [0145] In certain embodiments, the CAR intracellular signaling domain comprises a human CD28 transmembrane domain. The human CD28 transmembrane domain can comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to SEQ ID NO: 92 or fragment thereof, and / or may optionally comprise up to one, or up to two or even three conservative amino acid substitutions. SEQ ID NO: 92 is provided below: FWVLVVVGGV LACYSLLVTV AFIIFWV [SEQ ID NO: 792].
[0146] [0146] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 92 is shown in SEQ ID NO: 93, which is provided as follows.
[0147] [0147] In certain embodiments, the transmembrane domain of a currently described CAR comprises a natural or modified transmembrane domain of a CD84 polypeptide. The CD84 polypeptide can have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 001171808.1 (SEQ ID No: 1), or a fragment thereof, and / or can optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the CD84 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 1 that has at least 20, or at least 30, or at least 40, or at least 50 and up to 220 amino acids in size. Alternatively, or in addition, in various non-limiting modalities, the CD84 polypeptide comprises or presents an amino acid sequence of amino acids 1 to 220, 1 to 50, 50 to 100, 100 to 150, 114 to 220, 150 to 200, or 200 to 220 of SEQ ID NO: 1. In certain embodiments, the CD84 polypeptide comprised in the transmembrane domain of a currently described CAR comprises or has an amino acid sequence of amino acids 226 to 250 of SEQ ID NO: 1.
[0148] [0148] SEQIDNO: 1 is provided below:
[0149] [0149] According to the subject in question currently described, a "CD84 nucleic acid molecule" refers to a polynucleotide that encodes a CD84 polypeptide. In certain embodiments, the CD84 nucleic acid molecule encoding the CD84 polypeptide with amino acids 226 to 250 of SEQ ID NO: 1 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 2, as provided below.
[0150] [0150] In certain embodiments, the transmembrane domain of a CAR currently described comprises a natural or modified transmembrane domain of a CD166 polypeptide. The CD166 polypeptide can have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 001618.2 (SEQ ID NO: 3), or a fragment thereof, and / or can optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the CD166 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 3 that has at least 20, or at least 30, or at least 40, or at least 50 and up to 220 amino acids in size. Alternatively, or in addition, in various non-limiting modalities, the CD166 polypeptide comprises or presents an amino acid sequence of amino acids 1 to 220, 1 to 50, 50 to 100, 100 to 150, 114 to 220, 150 to 200, or 200 to 220 of SEQ ID NO: 3. In certain embodiments, the CD166 polypeptide comprised in the transmembrane domain of a CAR currently described comprises or has an amino acid sequence of amino acids 528 to 553 of SEQ ID NO: 3. In certain embodiments, the CD166 polypeptide comprised in the transmembrane domain of a currently described CAR comprises or presents an amino acid sequence of amino acids 528 to 549 of SEQ ID NO: 3.
[0151] [0151] SEQ ID NO: 3 is the following is provided: 1 meskgasscr Ilfcllisat vfrpglgwyt vnsaygdtii ipcridvpagn Imfgkwkyek 61 pdaspvfiaf rsstkksvqy ddvpeykdrl niIsenytisi snarisdekr fvemlvtedn 121 vfeaptivkv fkgpskpeiv skalfleteg Ikklgdcise dsypdgnitw yrngkvlhpl 181 egavviifkk emdpvtalyt mtstleyktt kadigmpftc svtyygpsgaq ktihsegavf 241 diyypteqvt iqvippknai kegdnitlkc Igngnpppee fifyipgqgpe girssntyt 301 tdvrrnatad ykcslidkks miastaitvh yldisInpsg evtraigdal pvsctisasr 361 natvvwmkdn irlrsspsfs slhygdagny vcetalgeve glkkresitl ivegkpgikm 421 tkktdpsgls ktiichvegf pkpaiqwtit gsgsvingte espyingryy skilispeen 481 vtltetaenq lertvnslhv saisipehde adeisdenre kvndgakliv givvalllaa 541 Ivagvvywly mkksktaskh vnkdignmee nkKkleennhk tea [SEQ ID NO: 3].
[0152] [0152] According to the subject in question currently described, a "CD166 nucleic acid molecule" refers to a polynucleotide that encodes a CD166 polypeptide. In certain embodiments, the CD166 nucleic acid molecule encoding the CD166 polypeptide with amino acids 528 to 553 of SEQ ID NO: 3 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 4, as provided below.
[0153] [0153] In certain embodiments, the transmembrane domain of a currently described CAR comprises a natural or modified transmembrane domain of a CD8a polypeptide. The CD8a polypeptide can have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 001139345.1 (SEQ ID No: 5), or a fragment thereof, and / or can optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the CD8a polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 5 that has at least 20, or at least 30, or at least 40, or at least 50 and up to 220 amino acids in size. Alternatively, or in addition, in various non-limiting modalities, the CD8a polypeptide comprises or presents an amino acid sequence of amino acids 1 to 220, 1 to 50, 50 to 100, 100 to 150, 114 to 220, 150 to 200, or 200 to 220 of SEQ ID NO: 5. In certain embodiments, the CD8a polypeptide comprised in the transmembrane domain of a currently described CAR comprises or has an amino acid sequence of amino acids 183 to 207 of SEQ ID NO: 5.
[0154] [0154] SEQ ID NO: 5 is provided below: 1 malpvtalll plalllhaar psqfrvspld rtwnlgetve Ikcqvllsnp tsgeswlfgp 61 rgaaasptfl lyisqnkpka aegldtarfs gkrigdtfvl tlsdfrrene gyyfcesalsn 121 simyfshfvp vflpakpttt paprpptpap tiasqplIslr peacrpaagg avhtraldfa cdiyiwapla gtcgvills 181 | vitlyonhrn rrrveckcprp vvksgdkps! saryv [SEQ ID NO: 5)
[0155] [0155] According to the subject in question currently described, a "CD8a nucleic acid molecule" refers to a polynucleotide that encodes a CD8a polypeptide. In certain embodiments, the CD8a nucleic acid molecule encoding the CD8a polypeptide with amino acids 183 to 207 of SEQ ID NO: 5 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 6 as provided below.
[0156] [0156] In certain embodiments, the transmembrane domain of a currently described CAR comprises a natural or modified transmembrane domain of a CD8b polypeptide. The CD8b polypeptide can have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 742099.1 (SEQ ID No: 7), or a fragment thereof, and / or can optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the CD8b polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 7 that has at least 20, or at least 30, or at least 40, or at least 50 and up to 220 amino acids in size. Alternatively, or in addition, in various non-limiting embodiments, the CD8b polypeptide comprises or presents an amino acid sequence of amino acids 1 to 220, 1 to 50, 50 to 100, 100 to 150, 114 to 220, 150 to 200, or 200 to 220 of SEQ ID NO: 7. In certain embodiments, the CD8b polypeptide comprised in the transmembrane domain of a currently described CAR comprises or has an amino acid sequence of amino acids 171 to 195 of SEQ ID NO: 7.
[0157] [0157] SEQ ID NO: 7 is provided below: 1 mrpriwllla aqltvlhans vlggtpayik vatnkmvmls ceakislsnm riywlrarga 61 pssdshhefl alwdsakgti hgeevegeki avfrdasrfi Inltsvkped sgiyfemivg 121 speltfgkgt qlsvvdflpt taqgptkkstl kKkrvcriprp etakgplesp itlgllvagv 181 Ivllvslgva ihlccerrrra rirfmkglr! hpolekesrmd y [SEQ ID NO: 7]
[0158] [0158] According to the subject in question currently described, a "CD8b nucleic acid molecule" refers to a polynucleotide that encodes a CD8b polypeptide. In certain embodiments, the CD8b nucleic acid molecule encoding the CD8b polypeptide with amino acids 171 to 195 of SEQ ID NO: 7 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 8, as provided below.
[0159] [0159] In certain embodiments, the transmembrane domain of a currently described CAR comprises a natural or modified transmembrane domain of an ICOS polypeptide. The ICOS polypeptide can have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 036224.1 (SEQ ID No: 9), or a fragment thereof, and / or can optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the ICOS polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 9 that has at least 20, or at least 30, or at least 40, or at least 50 and up to 220 amino acids in size. Alternatively, or in addition, in various non-limiting modalities, the ICOS polypeptide comprises or presents an amino acid sequence of amino acids 1 to 220, 1 to 50, 50 to 100, 100 to 150, 114 to 220, 150 to 200, or 200 to 220 of SEQ ID NO: 9. In certain embodiments, the ICOS polypeptide comprised in the transmembrane domain of a currently described CAR comprises or has an amino acid sequence of amino acids 141 to 165 of SEQ ID NO: 9.
[0160] [0160] SEQID NO: 9 is provided below: 1 mksglwyffl fclrikvlta eingsanyem fifhnnggvai Ickypdivgq fkmallkggqg
[0161] [0161] According to the subject in question currently described, an “ICOS nucleic acid molecule” refers to a polynucleotide that encodes an ICOS polypeptide. In certain embodiments, the ICOS nucleic acid molecule encoding the ICOS polypeptide with amino acids 141 to 165 of SEQ ID NO: 9 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 10, as provided below.
[0162] [0162] In certain embodiments, the transmembrane domain of a CAR currently described comprises a natural or modified transmembrane domain of a CTLA-4 polypeptide. The CTLA-4 polypeptide can have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 005205.2 (SEQ ID No: 11), or fragment of same, and / or optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the CTLA-4 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 11 that has at least 20, or at least 30, or at least 40, or at least 50 and up to 220 amino acids in size. Alternatively, or in addition, in various non-limiting modalities, the CTLA-4 polypeptide comprises or presents an amino acid sequence of amino acids 1 to 220, 1 to 50, 50 to 100, 100 to 150, 114 to 220, 150 to 200, or 200 to 220 of SEQ ID NO: 11. In certain embodiments, the CTLA-4 polypeptide comprised in the transmembrane domain of a currently described CAR comprises or has an amino acid sequence of amino acids 162 to 186 of SEQ ID NO: 11.
[0163] [0163] SEQ ID NO: 11 is provided below: 1 macigfqarhk aqinlatrtw pctlilffilf ipvfckamhv aqpavvlass rgiasfvcey 61 aspgkatevr vtvirgadsqa vtevcaatym mgneltfidd sictgtssan qvnltigglr 121 amdtglyick velmypppyy Igigngtaiy vidpepcpads dfllwilaav ssglffysfl 181 ItavsIskml! kkrsplttav yvkmpptepe cekafapyfi pin [SEQ ID NO: 11]
[0164] [0164] According to the subject matter currently described, a "CTLAH nucleic acid molecule" refers to a polynucleotide that encodes a CTLA-4 polypeptide. In certain embodiments, the CTLA-4 nucleic acid molecule that encodes the polypeptide CTLA-4 with amino acids 162 to 186 of SEQ ID NO: 11 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 12, as provided below.
[0165] [0165] In certain embodiments, the transmembrane domain of a currently described CAR comprises a natural or modified transmembrane domain of an ICAM-1 polypeptide. The ICAM-1 polypeptide can have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 000192.2 (SEQ ID No: 13), or fragment of same, and / or optionally comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the ICAM-1 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 13 that has at least 20, or at least 30, or at least 40, or at least 50 and up to 220 amino acids in size.
[0166] [0166] SEQ ID NO: 13The provided below: 1 mapssprpal pallvilgal fogpgnaqts vspskvilpr ggsvlvtest sedapkligi 61 etplpkkell Ibpgnnrkvye Isnvgedsap mceysncpdaq staktfltvy wtpervelap 121 Ipswapvgkn ltircegvegg apranltvvl Irgekelkre pavgepaevt ttvivrrdhh 181 ganfscrtel dirpqaglelf entsapyala tfvipatppa Ivsprvlevd tagtvvesld 241 glfpvseaqv hlalgdqrin ptvtygndsf sakasvsvta edegtqritc avilgngsqge 301 tlgtvtiysf papnviltkp evsegtevtv kceahprakv tingvpaqp! gpraqlilka 361 tpedngrsfs csatlevaga lihkngtrel rviygpride rdcpgnwtwp ensqagtpmeq 421 awgnplpelk clkdgtíplp igesvtvtrd legtylcrar stagevtrkv tunvisprye 481 viktggtk ktgtk kt
[0167] [0167] According to the subject in question currently described, an “ICAM-1 nucleic acid molecule” refers to a polynucleotide that encodes an ICAM-1 polypeptide. In certain embodiments, the ICAM-1 nucleic acid molecule that encodes the ICAM-1 polypeptide with amino acids 481 to 507 of SEQ ID NO: 13 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 14, as provided below.
[0168] [0168] In certain non-limiting embodiments, a CAR may also comprise a hinge / spacer region that links the extracellular antigen binding domain to the transmembrane domain. The hinge / spacer region can be flexible enough to allow the antigen binding domain to orient itself, in different directions, to facilitate antigen recognition. In certain non-limiting embodiments, the hinge / spacer region of the CAR may comprise a natural or modified hinge region of a CD8 polypeptide, a CD28 polypeptide, a CD37 polypeptide, a CD40 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, a CD84 polypeptide, a CD166 polypeptide, a CD8a polypeptide, a CD8b polypeptide, an ICOS polypeptide, an ICAM-1 polypeptide, a CTLA-4 polypeptide, a CD27 polypeptide, a CD40 / My88 peptide, an NKGD2 peptide, a synthetic polypeptide ( which is not based on a protein associated with the immune response), or a combination of them. The hinge / spacer region can be the IgG1 hinge region, or the CH2CH; 3 region of immunoglobulin and CD3 portions, a portion of a CD28 polypeptide (for example, a portion of SEQ ID NO: 90), a portion of a CD8 polypeptide (for example, a portion of SEQ ID NO: 86, or a portion of SEQ ID NO: 87), a variation of any of the foregoing, which is at least about 80%, at least about 85 %, at least about 90%, at least about 95%, or at least about 100% homologous or identical thereto, or a synthetic spacer sequence.
[0169] [0169] In certain embodiments, the hinge / spacer region of a currently described CAR comprises a natural or modified hinge region of a CD28 polypeptide, as described herein. In certain embodiments, the CD28 polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or presents an amino acid sequence of amino acids 114 to 152 of SEQ ID NO: 90. In certain embodiments, the CD28 nucleic acid molecule encoding the CD28 polypeptide with amino acids 114 to 152 of SEQ ID NO: 90 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 15, as provided below.
[0170] [0170] In certain embodiments, the hinge / spacer region of a currently described CAR comprises a natural or modified hinge region of a CD84 polypeptide, as described herein. In certain embodiments, the CD84 polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or exhibits an amino acid sequence of amino acids 187 to 225 of SEQ ID NO: 1. In certain embodiments, the CD84 nucleic acid molecule encoding the CD84 polypeptide with amino acids 187 to 225 of SEQ ID NO: 1 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 16, as provided below. CAAGAGCTGACTTACACGTGTACAGCCCAGAACCCTGTCAGCAACAA
[0171] [0171] In certain embodiments, the hinge / spacer region of a currently described CAR comprises a natural or modified hinge region of a CD1I66 polypeptide, as described herein. In certain embodiments, the CD166 polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or has amino acids 489 to 527 of SEQ ID NO: 3. In certain embodiments, the CD166 nucleic acid molecule encoding the CD166 polypeptide with amino acids 489 to 527 of SEQ ID NO: 3 comprises or displays nucleic acids with the sequence shown in SEQ ID NO: 17, as provided below. ACCAACTGGAGAGAACAGTAAACTCCTTGAATGTCTCTGCTATAAGTA
[0172] [0172] In certain embodiments, the CD166 polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or has amino acids 484 to 527 of SEQ ID NO: 3. In certain embodiments, the polypeptide
[0173] [0173] In certain embodiments, the CD166 polypeptide comprised in the hinge / spacer region and the transmembrane domain of a currently described CAR comprises or presents the amino acid sequence shown in SEQ ID NO: 111, 112, 113, 114, 115, 116 or 117.
[0174] [0174] In certain embodiments, the hinge / spacer region of a currently described CAR comprises a natural or modified hinge region of a CD8a polypeptide, as described herein. In certain embodiments, the CD8a polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or has amino acids 137 to 182 of SEQ ID NO:
[0175] [0175] In certain embodiments, the hinge / spacer region of a currently described CAR comprises a natural or modified hinge region of a CD8b polypeptide, as described herein. In certain embodiments, the CD8b polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or has amino acids 132 to 170 of SEQ ID NO:
[0176] [0176] In certain embodiments, the hinge / spacer region of a CAR currently described comprises a natural or modified hinge region of an ICOS polypeptide, as described herein. In certain embodiments, the ICOS polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or has amino acids 102 to 140 of SEQ ID NO:
[0177] [0177] In certain embodiments, the hinge / spacer region of a currently described CAR comprises a natural or modified hinge region of a CTLA4 polypeptide, as described herein. In certain embodiments, the CTLA-4 polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or has amino acids 123 to 161 of SEQ ID NO:
[0178] [0178] In certain embodiments, the hinge / spacer region of a currently described CAR comprises a natural or modified hinge region of an ICAM-1 polypeptide, as described herein. In certain embodiments, the ICAM-1 polypeptide comprised in the hinge / spacer region of a currently described CAR comprises or has amino acids 442 to 480 of SEQ ID NO:
[0179] [0179] In certain embodiments, a CAR currently described comprises a hinge / spacer region. In certain embodiments, the hinge / spacer region is positioned between the extracellular antigen binding domain and the transmembrane domain. In certain embodiments, the hinge / spacer region comprises a CD8 polypeptide, a CD28 polypeptide, a CD36 polypeptide, a CDA4 polypeptide, a 4-1BB polypeptide, an OXA40 polypeptide, a CD166 polypeptide, a CD8 polypeptide, a CD8b polypeptide, ICOS polypeptide, ICAM-1 polypeptide, CTLA-4 polypeptide, CD27 polypeptide, CD40 / My88 peptide, NKGD2 peptide, synthetic polypeptide (which is not based on a protein associated with the immune response), or a combination of themselves. In certain embodiments, the transmembrane domain comprises a CD8 polypeptide, a CD28 polypeptide, a CD376 polypeptide, a CDA4 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, a CD166 polypeptide, a CD8a polypeptide, a CD8b polypeptide, an ICOS polypeptide an ICAM-1 polypeptide, a CTLA-4 polypeptide, a CD27 polypeptide, a CD40 / My88 peptide, an NKGD2 peptide, a synthetic polypeptide (which is not based on an immune-associated protein), or a combination thereof.
[0180] [0180] In certain embodiments, the transmembrane domain and the hinge / spacer region are derived from the same molecule. In certain embodiments, the transmembrane domain and the hinge / spacer region are derived from different molecules. In certain embodiments, the hinge / spacer region of the CAR comprises a CD28 polypeptide and the transmembrane domain of the CAR comprises a CD28 polypeptide. In certain modalities,
[0181] [0181] In certain non-limiting embodiments, an intracellular signaling domain of the CAR comprises a CD376 polypeptide, which can activate or stimulate a cell (for example, a cell of the lymphoid lineage, for example, a T cell). Wild type (“natural”) CD3Z comprises three tyrosine-based immunoreceptor activation motifs (“TAMs”) (for example, ITAM1, ITAM2 and ITAM3), three regions of rich basic extension (BRS) (BRS1, BRS2 and BRS3 ), and transmits an activation signal to the cell (for example, a cell of the lymphoid lineage, for example, a T cell) after the antigen is turned on. The intracellular signaling domain of the natural CD37 chain is the primary transmitter of signals from endogenous TORs. CD36, as used here in modalities, is not natural CD36, but it is a modified CD37. In certain embodiments, the modified CD37 polypeptide comprises or has an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96 %, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 932170 (SEQ ID No: 94 ), or fragment thereof. In certain non-limiting embodiments, the modified CD37 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 94, which is at least 20, or at least 30, or at least 40, or at least 50, or at least 100, or at least 110, or at least 113, and up to 163 amino acids in size. Alternatively, or in addition, in various non-limiting embodiments, the modified CD37 polypeptide comprises or has an amino acid sequence of amino acids 1 to 50, 50 to 100, 100 to 150, 50 to 164, 55 to 164, or 150 to 164 of SEQ ID NO: 94. In certain embodiments, the modified CD36 polypeptide comprises or has an amino acid sequence of amino acids 52 to 164 of SEQ ID NO: 94.
[0182] [0182] SEQ ID NO: 94 is provided below: 1 MKWKALFTAA ILQAQLPITE AQSFGLLDPK LCYLLDGILF IYGVILTALF
[0183] [0183] In certain embodiments, the CAR intracellular signaling domain comprises a modified human CD36 polypeptide. The modified human CD36 polypeptide may comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to SEQ ID NO: 95 or fragment thereof, and / or may optionally comprise up to one , or up to two or even three conservative amino acid substitutions. SEQ ID NO: 95 is provided as follows: RVKFSRSADA - PAYQQGOANQL —YNELNLGRRE EYDVLDKRRG RDPEMGGKPR RKNPQEGLYN
[0184] [0184] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 95 is shown in SEQ ID NO: 96, which is provided as follows. AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGG GCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGAT GTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAA GGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCG GAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGC
[0185] [0185] In certain non-limiting embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising one, two or three ITAMs. In certain embodiments, the modified CD376 polypeptide comprises a natural ITAM1 comprising the amino acid sequence shown in SEQ ID NO: 23.
[0186] [0186] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 23 is shown in SEQ ID NO: 24, which is provided as follows.
[0187] [0187] In certain embodiments, the modified CD36 polypeptide comprises a variation of ITAM1 comprising one or more mutations with loss of function. In certain embodiments, the modified CD37 polypeptide exhibits a variation of ITAM1 comprising two mutations with loss of function. In certain modalities,
[0188] [0188] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 25 is shown in SEQ ID NO: 26, which is provided as follows.
[0189] [0189] In certain embodiments, the modified CD37 polypeptide comprises a natural ITAM2 comprising the amino acid sequence shown in SEQ ID NO: 27, which is provided as follows.
[0190] [0190] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 27 is shown in SEQ ID NO: 28, which is provided as follows.
[0191] [0191] In certain embodiments, the modified CD36 polypeptide comprises a variation of ITAM2 comprising one or more mutations with loss of function. In certain embodiments, the modified CD37 polypeptide exhibits a variation of ITAM2 comprising two mutations with loss of function. In certain embodiments, the loss-of-function mutation comprises a mutation of a tyrosine residue in ITAM2. In certain embodiments, the ITAM2 variation consisting of two loss-of-function mutations comprises the amino acid sequence shown in SEQ ID NO: 29, which is provided as follows.
[0192] [0192] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 29 is shown in SEQ ID NO: 30, which is provided as follows. caggaaggcctgtTcaatgaactgcagaaagataagatggcagaggacctTcagigagatiggagat gaaa [SEQ ID NO: 30].
[0193] [0193] In certain embodiments, the modified CD37 polypeptide comprises a natural ITAM3 comprising the amino acid sequence shown in SEQ ID NO: 31, which is provided as follows. HDGLYQGLSTATKDTYDALHMA [SEQ ID NO: 31].
[0194] [0194] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 131 is shown in SEQ ID NO: 32, which is provided as follows. cacgatggcctttaccagggteteagtacagecaccaaggacacctacgacgccctticacatacag [SEQ ID NO: 32].
[0195] [0195] In certain embodiments, the modified CD36 polypeptide comprises a variation of ITAM3 comprising one or more mutations with loss of function. In certain embodiments, the modified CD36 polypeptide exhibits a variation of ITAM3 comprising two mutations with loss of function. In certain embodiments, the loss-of-function mutation comprises a mutation of a tyrosine residue in ITAM3. In certain embodiments, the ITAM3 variation consisting of two loss-of-function mutations comprises the amino acid sequence shown in SEQ ID NO: 33, which is provided as follows. HDGLFQGLSTATKDTFDALHMOQ [SEQ | D NO: 33].
[0196] [0196] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 33 is shown in SEQ ID NO: 34, which is provided as follows. cacgatggcctttTccaggggcteagtacagecaccaaggacaccetTcgacgcccttcacatacag [SEQ ID NO: 34].
[0197] [0197] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising, or consisting essentially of, or consisting of a variation of ITAM1 comprising one or more mutations with loss of function, a variation of ITAM2 comprising a or more mutations with loss of function, a variation of ITAM3 comprising one or more mutations with loss of function, or a combination thereof. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a variation of ITAM2 comprising one or more (for example, two) loss-of-function mutations, and a variation of ITAM3 comprising one or more (for example , two) mutations with loss of function. In certain embodiments, the intracellular signaling domain of the CAR comprises a modified CD36 polypeptide comprising a natural ITAM1, a variation of ITAM2 comprising two mutations with loss of function, and a variation of ITAM3 comprising two mutations with loss of function. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD37 polypeptide comprising a natural ITAM1 with the amino acid sequence shown in SEQ ID NO: 23, a variation of ITAM2 with the amino acid sequence shown in SEQ ID NO: 29 and a variation of ITAM3 with the amino acid sequence shown in SEQ ID NO: 33 (for example, a construction called “1XX”).
[0198] [0198] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a variation of ITAM1 comprising one or more (e.g., two) loss-of-function mutations, and a variation of ITAM3 comprising one or more (for example, two) mutations with loss of function. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a variation of ITAM1 that comprises two mutations with loss of function, a natural ITAMZ2, and a variation of ITAM3 comprising two mutations with loss of function. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD37 polypeptide comprising a variation of ITAM1 with the amino acid sequence shown in SEQ ID NO: 25, a natural ITAM2 with the amino acid sequence shown in SEQ ID NO: 27 and a variation of ITAM3 with the amino acid sequence shown in SEQ ID NO: 33 (for example, a construction called “X2X”).
[0199] [0199] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a variation of ITAM1 that comprises one or more (e.g., two) loss-of-function mutations, and a variation of ITAM2 comprising one or more (for example, two) mutations with loss of function. In certain embodiments, the intracellular signaling domain of the CAR comprises a modified CD36 polypeptide comprising a variation of ITAM1 comprising two mutations with loss of function, a variation of ITAM2 comprising two mutations with loss of function, and a natural ITAM3. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a variation of ITAM1 with the amino acid sequence shown in SEQ ID NO: 25, a variation of ITAM2 with the amino acid sequence shown in SEQ ID NO: 29 , and a natural ITAM3 with the amino acid sequence shown in SEQ ID NO: 31 (for example, a construction called “XX3”).
[0200] [0200] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD37 polypeptide comprising a variation of ITAM1 comprising one or more (for example, two) loss-of-function mutations. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD37 polypeptide comprising a variation of ITAM1 comprising two loss-of-function mutations, a natural ITAM2, and a natural ITAM3. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a variation of ITAM1 with the amino acid sequence shown in SEQ ID NO: 27, a natural ITAM2 with the amino acid sequence shown in SEQ ID NO: 29, and a natural ITAM3 with the amino acid sequence shown in SEQ ID NO: 31 (for example, a construction called "X23").
[0201] [0201] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a natural ITAM1, a natural ITAM2, and a variation of ITAM3 comprising one or more (for example, two) loss-of-function mutations. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD37 polypeptide comprising a natural ITAM1, a natural ITAM2, and a variation of ITAM1 comprising two mutations with loss of function. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a natural ITAM1 with the amino acid sequence shown in SEQ ID NO: 23, a natural ITAM 2 with the amino acid sequence shown in SEQ ID NO: 27 and a variation of ITAM3 with the amino acid sequence shown in SEQ ID NO: 33 (for example, a construction called “12X”).
[0202] [0202] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a natural ITAM1, a variation of ITAM2 comprising one or more (e.g., two) loss-of-function mutations, and a natural ITAM3. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a natural ITAM1, a variation of ITAM2 comprising two mutations with loss of function, and a natural ITAM3. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a natural ITAM1 with the amino acid sequence shown in SEQ ID NO: 23, a variation of ITAM2 with the amino acid sequence shown in SEQ ID NO: 29, and a natural variation of ITAM3 with the amino acid sequence shown in SEQ ID NO: 31 (for example, a construction called “1X3”).
[0203] [0203] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising an elimination of one or two ITAMs. In certain embodiments, the modified CD36 polypeptide comprises an elimination of ITAM1 and ITAM2, for example, the modified CD37 polypeptide comprises a natural ITAM3 or a variation of ITAM3, and does not comprise an ITAM1 or an ITAM2. In certain embodiments, the modified CD36 polypeptide comprises a natural ITAM3 with the amino acid sequence shown in SEQ ID NO: 31, and does not comprise an ITAM1 (natural or modified), or an ITAM2 (natural or modified) (for example, D12) .
[0204] [0204] In certain embodiments, the modified CD36 polypeptide comprises an elimination of ITAM2 and ITAM3, for example, the modified CD36 polypeptide comprises a natural ITAM1 or a variation of ITAM1, and does not comprise an ITAM2 or an ITAM3. In certain embodiments, the modified CD36 polypeptide comprises a natural ITAM1 with the amino acid sequence shown in SEQ ID NO: 23, and does not comprise an ITAM2 (natural or modified), or an ITAM3 (natural or modified) (for example, D23) .
[0205] [0205] In certain embodiments, the modified CD36 polypeptide comprises an elimination of ITAM1 and ITAM3, for example, the modified CD36 polypeptide comprises a natural ITAM2 or a variation of ITAM2, and does not comprise an ITAM1 or an ITAM3. In certain embodiments, the modified CD36 polypeptide comprises a natural ITAM2 with the amino acid sequence shown in SEQ ID NO: 27, and does not comprise an ITAM1 (natural or modified), or an ITAM3 (natural or modified) (for example, D13) .
[0206] [0206] In certain embodiments, the modified CD36 polypeptide comprises an elimination of ITAM1, for example, the modified CD376 polypeptide comprises a natural ITAM2 or a variation of ITAM2, and a natural ITAM3 or a variation of ITAM3, and does not comprise an ITAM1 ( natural or modified).
[0207] [0207] In certain embodiments, the modified CD36 polypeptide comprises an elimination of ITAM2, for example, the modified CD37 polypeptide comprises a natural ITAM1 or a variation of ITAM1, and a natural ITAM3 or a variation of ITAM3, and does not comprise an ITAM 2 (natural or modified).
[0208] [0208] In certain embodiments, the modified CD36 polypeptide comprises an elimination of ITAM3, for example, the modified CD37 polypeptide comprises a natural ITAM1 or a variation of ITAM1, and a natural ITAM2 or a variation of ITAM2, and does not comprise an ITAM3 ( natural or modified). RICH BASIC EXTENSION REGION (BRS)
[0209] [0209] In certain non-limiting embodiments, the CAR intracellular signaling domain comprises a modified CD376 polypeptide comprising one, two or three BRS regions (i.e., BRS1, BRS2 and BRS3). The BRS region can be a natural BRS or a modified BRS (for example, a variation of BRS). In certain embodiments, the modified CD36 polypeptide comprises a natural BRS1 region comprising the amino acid sequence shown in SEQ ID NO: 35, which is provided as follows.
[0210] [0210] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 35 is shown in SEQ ID NO: 36, which is provided as follows.
[0211] [0211] In certain embodiments, the modified CD36 polypeptide comprises a variation of BRS1 comprising one or more mutations with loss of function.
[0212] [0212] In certain embodiments, the modified CD36 polypeptide comprises a natural BRS2 comprising the amino acid sequence shown in SEQ ID NO: 37.
[0213] [0213] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 37 is shown in SEQ ID NO: 38, which is provided as follows.
[0214] [0214] In certain embodiments, the modified CD36 polypeptide comprises a variation of BRS2 comprising one or more mutations with loss of function.
[0215] [0215] In certain embodiments, the modified CD36 polypeptide comprises a
[0216] [0216] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 39 is shown in SEQ ID NO: 40, which is provided as follows.
[0217] [0217] In certain embodiments, the modified CD36 polypeptide comprises a variation of BRS3 comprising one or more mutations with loss of function.
[0218] [0218] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising all three BRS regions, that is, a BRS1 region, a BRS2 region and a BRS3 region. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a natural BRS1, a natural BRS2 and a natural BRS3. In certain embodiments, the CAR intracellular signaling domain comprises a modified CD36 polypeptide comprising a natural BRS1 with the amino acid sequence shown in SEQ ID NO: 35, a natural BRS2 with the amino acid sequence shown in SEQ ID NO: 37, and a natural BRS3 with the amino acid sequence shown in SEQ ID NO: 39, for example, the modified CD36 polypeptide comprised in construct 1 XX.
[0219] [0219] In certain embodiments, the CAR intracellular signaling domain comprises a modified CD37 polypeptide comprising one or two, but not all three BRS regions. In certain embodiments, the modified CD36 polypeptide comprises a BRS1 region and a BRS2 region, and does not comprise a BRS3 region. In certain embodiments, the modified CD36 polypeptide comprises a BRS1 region and a BRS3 region, and does not comprise a BRS2 region. In certain embodiments, the modified CD376 polypeptide comprises a BRS2 region and a BRS3 region, and does not comprise a BRS1 region.
[0220] [0220] In certain embodiments, the modified CD36 polypeptide comprises a BRS1 region, and does not comprise a BRS2 region or a BRS3 region. In certain embodiments, the modified CD36 polypeptide comprises a natural BRS1 with the amino acid sequence shown in SEQ ID NO: 35, and does not comprise a BRS2 region or a BRS3 region, for example, the modified CD37 polypeptide comprised in construction D23. In certain embodiments, the modified CD37 polypeptide comprises a BRS2 region, and does not comprise a BRS1 region or BRS3 region. In certain embodiments, the modified CD36 polypeptide comprises a BRS3 region, and does not comprise a BRS1 region or a BRS2 region.
[0221] [0221] In certain embodiments, the modified CD37 polypeptide does not comprise a BRS region (BRS1, BRS2 or natural or modified BRS3), for example, all three BRSs are eliminated, for example, the modified CD36 polypeptide comprised in construction D12.
[0222] [0222] In certain non-limiting embodiments, the CAR comprises an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD37 polypeptide, wherein the modified CD36 polypeptide lacks all or part of the motifs tyrosine-based immunoreceptor activation (ITAMs), in which ITAMs are ITAM1, ITAM2 and ITAM3. In certain embodiments, the modified CD36 polypeptide lacks ITAM2 or a portion of it. In certain embodiments, the modified CD37 polypeptide additionally lacks ITAM3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide additionally lacks ITAM1 or a portion thereof. In certain embodiments, the modified CD37 polypeptide lacks ITAM1 or a portion of it. In certain embodiments, the modified CD37 polypeptide additionally lacks ITAM3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide lacks ITAM3 or a portion of it. In certain embodiments, the modified CD37 polypeptide lacks all or part of the regions of rich basic extension (BRS), where the BRS regions are BRS1, BRS2 and BRS3. In certain embodiments, the modified CD36 polypeptide lacks BRS2 or a portion thereof. In certain embodiments, the modified CD37 polypeptide additionally lacks BRS3 or a portion thereof. In certain embodiments, the modified CD36 polypeptide additionally lacks BRS1 or a portion thereof. In certain embodiments, the modified CD36 polypeptide lacks BRS1 or a portion thereof. In certain embodiments, the modified CD37 polypeptide additionally lacks BRS3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide lacks BRS3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide lacks BRS1 or a portion thereof, BRS2 or a portion thereof, and BRS3 or a portion thereof. In certain embodiments, the modified CD37 polypeptide lacks ITAM2, ITAM3, BRS2 and BRS3. In certain embodiments, the CAR comprises the amino acid sequence shown in SEQ ID NO: 45 or SEQ ID NO: 47. In certain embodiments, the CAR comprises an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, in which the modified CD36 polypeptide lacks all or part of the regions of rich basic extension (BRS), in which the BRS regions are BRS1, BRS2 and BRS3. In certain embodiments, the CAR comprises an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD37 polypeptide, wherein the modified CD36 polypeptide comprises a variation of BRS selected from a variation of BRS1 , a variation of BRS2, and a variation of BRS3, in which the variation of BRS comprises one or more mutations with loss of function. CO-STIMULATORY SIGNALING REGION
[0223] [0223] In certain non-limiting embodiments, a CAR intracellular signaling domain additionally comprises at least one co-stimulatory signaling region. In certain embodiments, the co-stimulatory signaling region comprises at least one co-stimulatory molecule, which can provide activation of ideal lymphocyte.
[0224] [0224] As used herein, "co-stimulatory molecules" refer to cell surface molecules, other than antigenic receptors or their ligands that are required for an efficient lymphocyte response to antigen. At least one signaling region co- The stimulatory action may include a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP-10 polypeptide, a CD27 polypeptide, a CD40 / My88 peptide, an NKGD2 peptide or a combination thereof. stimulatory can bind to a co-stimulatory ligand, which is a protein expressed on the cell surface, which by binding to its receptor produces a co-stimulatory response, that is, an intracellular response that affects the stimulus provided when an antigen binds to the its CAR molecule. Co-stimulatory ligands include, but are not limited to CD80, CD86, CD70, OXA40L and 4-1BBL. As an example, a 4-1BB (ie 4-1BBL) ligand can bind to 4- 1BB (also known as mo “CD137”) to provide an intracellular signal that, in combination with a CAR signal, reduces an effector cell function of the CAR * T cell. CARs comprising an intracellular signaling domain comprising a costimulatory signaling region comprising 4-1BB, ICOS or DAP-10 are described in U.S. 7,446,190, which is incorporated herein by the reference in its entirety.
[0225] [0225] In certain embodiments, the CAR intracellular signaling domain comprises a co-stimulatory signaling region comprising a CD28 polypeptide. The CD28 polypeptide can comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the sequence with an NCBI reference number: P10747 or NP 006130 (SEQ ID NO: 90), or fragment thereof, and / or may optionally comprise up to one, or even two or even three, conservative amino acid substitutions. In certain non-limiting embodiments, the CD28 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 90 that has at least 20, or at least 30, or at least 40, or at least 50 and up to 220 amino acids in size.
[0226] [0226] In certain embodiments, the CD28 polypeptide comprises or has an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the sequence with an NCBI reference number: NP 031668.3 (SEQ ID NO : 97), or fragment thereof, and / or optionally may comprise up to one, or even two or even three conservative amino acid substitutions. In certain non-limiting embodiments, the CD28 polypeptide comprises or has an amino acid sequence that is a consecutive portion of SEQ ID NO: 97 that has at least about 20, or at least about 30, or at least about 40, or at least about 50 and up to 218 amino acids in size. Alternatively, or in addition, in various non-limiting modalities, the CD28 polypeptide comprises or presents an amino acid sequence of amino acids 1 to 218, 1 to 50, 50 to 100, 100 to 150, 114 to 220, 150 to 200, 178 to 218 , or 200 to 220 of SEQ ID NO: 97. In certain embodiments, the co-stimulatory signaling region of a currently described CAR comprises a CD28 polypeptide comprising or displaying amino acids 178 to 218 of SEQ ID NO: 97.
[0227] [0227] SEQIDNO: 97 is provided below: 1 MTLRLLFLAL - NFFSVQVTEN - KILVKOSPLL —VVDSNEVSLS
[0228] [0228] According to the subject in question currently described, a "CD28 nucleic acid molecule" refers to a polynucleotide that encodes a CD28 polypeptide. In certain embodiments, a CD28 nucleic acid molecule that encodes a CD28 polypeptide comprised in the region of co-stimulatory signaling of a currently described CAR (for example, amino acids 178 to 218 of SEQ ID NO: 97) comprises or presents a nucleotide sequence shown in SEQ ID NO: 98, which is provided as follows.
[0229] [0229] In certain embodiments, the CAR intracellular signaling domain comprises a murine CD28 intracellular signaling domain. The murine CD28 intracellular signaling domain can comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to SEQ ID NO: 99 or a fragment thereof, and / or optionally comprise up to one, or even two or even three conservative amino acid substitutions. SEQ ID NO: 99 is provided below: NSRRNRLLOS DYMNMTPRRP GLTRKPYQPY APARDFAAYR P [SEQ | D NO: 99].
[0230] [0230] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 99 is shown in SEQ ID NO: 100, which is provided as follows. AATAGTAGAAGGAACAGACTCCTTCAAAGTGACTACATGAACATGACT
[0231] [0231] In certain embodiments, the CAR intracellular signaling domain comprises a human CD28 intracellular signaling domain. The human CD28 intracellular signaling domain can comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to SEQ ID NO: 101 or a fragment thereof, and / or optionally comprise up to one, or even two or even three conservative amino acid substitutions. SEQ ID NO: 101 is provided below: RSKRSRLLHS DYMNMTPRRP GPTRKHYQPY APPRDFAAYR S [SEQ ID NO: 101].
[0232] [0232] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 70 is shown in SEQ ID NO: 102, which is provided as follows.
[0233] [0233] In certain embodiments, the CAR intracellular signaling domain comprises a de-immunized human CD28 intracellular signaling domain. The de-immunized human CD28 intracellular signaling domain may comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to SEQ ID NO: 108 or a fragment thereof, and / or it can optionally comprise up to one, or even two or even three conservative amino acid substitutions. SEQ ID NO: 108 is provided below: RSKRSRLLHS DYMNMTPRRP GPTRKHYQPY APPRDFAAYR K [SEQ ID NO: 108].
[0234] [0234] In certain embodiments, the CAR intracellular signaling domain comprises a co-stimulatory signaling region comprising two co-stimulatory molecules, for example, co-stimulatory signaling regions of CD28 and 4-1BB or co-signaling regions -stimulations of CD28 and OX40.
[0235] [0235] 4-1BB can act as a tumor necrosis factor (TNF) ligand and present stimulatory activity. The 4-1BB polypeptide may comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the sequence with an NCBI reference number: P41273 or NP 001552 (SEQ ID NO: 103 ) or fragment thereof, and / or optionally may comprise up to one, or even two or even three, conservative amino acid substitutions.
[0236] [0236] SEQ ID NO: 103 is provided below: 1 MGNSCYNIVA TLLLVLNFER TRSLODPCSN CPAGTFCDNN
[0237] [0237] According to the subject in question currently described, a “4-1BB nucleic acid molecule” refers to a polynucleotide that encodes a polypeptide
[0238] [0238] In certain embodiments, the CAR intracellular signaling domain comprises a 4-1BB intracellular signaling domain. The 4-1BB intracellular signaling domain can comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to SEQ ID NO: 104 or a fragment thereof, and / or optionally comprise up to one, or even two or even three conservative amino acid substitutions. SEQ ID NO: 104 is provided as follows: KRGRKKLLYI | FKQPFMRPVQ TTQEEDGCSC RFPEEEEGGC EL [SEQ ID NO: 104].
[0239] [0239] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 104 is shown in SEQ ID NO: 105, which is provided as follows. AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATG
[0240] [0240] An OX40 polypeptide can comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96% at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the sequence with an NCBI reference number: P43489 or NP 003318 (SEQ ID NO: 106), or fragment thereof, and / or may optionally comprise up to one, or even two or even three conservative amino acid substitutions.
[0241] [0241] SEQIDNO: 106 is provided as follows: 1 MCVGARRLGR GPCAALLLLG LGLSTVTGLH CVGDTYPSND RCCHECRPGN GMVSRCSRSQ
[0242] [0242] According to the subject in question currently described, an "OX40 nucleic acid molecule" refers to a polynucleotide that encodes an OX40 polypeptide.
[0243] [0243] An ICOS polypeptide can comprise or have an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96% at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or homologous identical to the sequence with an NCOBI reference number: NP 036224 (SEQ ID NO: 65 ) or fragment thereof, and / or optionally may comprise up to one, or even two or even three, conservative amino acid substitutions.
[0244] [0244] SEQ ID NO: 65 is provided below: 1 MKSGLWYFFL FCLRIKVLTG EINGSANYEM FIFHNGGVQ!
[0245] [0245] According to the subject in question currently described, an “ICOS nucleic acid molecule” refers to a polynucleotide that encodes a polypeptide ICOS.
[0246] [0246] In certain embodiments, a currently described CAR further comprises an inducible promoter to express nucleic acid sequences in human cells. Promoters for use in the expression of CAR genes can be a constitutive promoter, such as ubiquitin C (UbiC) promoter.
[0247] [0247] In certain embodiments, mutation and / or junction sites between CAR domains / motifs / regions derived from different proteins are de-immunized. The immunogenicity of junctions between different CAR fractions can be predicted using NetMHC 4.0 Server. For each peptide containing at least one amino acid of the following fraction, the binding affinity for HLA A, B and C, for all alleles, can be predicted. An immunogenicity score for each peptide can be assigned to each peptide. The immunogenicity score can be calculated using the immunogenicity score formula = [(50-binding affinity) * HLA frequency] n. n is the prediction number for each peptide.
[0248] [0248] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (e.g., a human CD19 polypeptide), a transmembrane domain, and a hinge / spacer region derived from a polypeptide CD28, an intracellular signaling domain comprising a modified CD36 polypeptide (for example, a modified human CD36 polypeptide) comprising a natural ITAM1, a natural ITAM2, a natural ITAM3, a natural BRS1, a natural BRS 2 and a natural BRS3, and a costimulatory signaling region comprising a CD28 polypeptide (for example, a human CD28 polypeptide). In certain embodiments, the CAR is called “19282 WT". In certain embodiments, the CAR (for example, 1928z WT) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to amino acid sequence shown in SEQ ID NO: 41, which is provided as follows: SEQ ID NO: 41 includes a major CD8 sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19) . MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTVSSGGGGSGGGGSGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRAAAIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADA
[0249] [0249] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 41 is shown in SEQ ID NO: 42, which is provided as follows.
[0250] [0250] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (for example, a human CD19 polypeptide), a transmembrane domain and a hinge / spacer region derived from a polypeptide CD28, an intracellular signaling domain comprising a modified CD36 polypeptide (for example, a modified human CD36 polypeptide) comprising a natural ITAM1, a natural BRS1, a natural BRS2, a natural BRS3, a variation of ITAM2 with two loss-of-function mutations , and a variation of ITAM3 with two loss-of-function mutations, and a co-stimulatory signaling region comprising a CD28 polypeptide (for example, a human CD28 polypeptide). In certain modalities, the CAR is called “IXX”. In certain embodiments, the CAR (for example, 1XX) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the amino acid sequence shown in SEQ ID NO: 43, which is provided as follows. SEQ ID NO: 43 includes a CD8 major sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTVSSGGGGSGGGGSGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRAAAIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADA
[0251] [0251] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 43 is shown in SEQ ID NO: 44, which is provided as follows. atggctcteccagtgactgccectactgcetticecetagegettctectacatacagaggatgaagetagcage agtctagggctgagctagtgaggcctagatectcagigaagatttectacaaggacttctagctatgcattcagtagctact ggatgaactgggtgaagcagaggcctagacagggtcttaagitggattggacagatttatcctagagatggtgatacta actacaatggaaagttcaagggteaagecacactgactgcagacaaatcctecagcacagectacatgcageteag cggcctaacatctgaggactctacggtctatttetatacaagaaagaccattagttcggtagtagatttctacttigactact ggggccaagggaccacagteacegtetecteaggtagaggtagatcaggtagaggtagatctagtagaggatagatc tgacattgagctcacccagtetecaaaattcatgtecacatcagtaggagacagggteagegteacetacaaggeca gtcagaatgtaggtactaatgtagcctagtatcaacagaaaccaggacaatcetectaaaccactgatttacteggcaa ccectaceggaacagtagagtcecectgategetticacaggcagtggatctgggacagattteacteteaccateactaacat gcagtctaaagacttggcagactatttetgteaacaatataacaggtatcegtacacgtecggaggggggaccaaget ggagatcaaacgggcggcegceaattgaagttatatatcctectecttacetagacaatagagaagagcaatggaacca ttatccatgtgaaagggaaacacctttgtecaagtecectattteceggaccttetaageccttttaggtactagtagtagtt ggataggagtccetagettgctatagcttgctagta acagtagoectttattattttetaggtaaggagtaagaggagcaggcte ctgcacagtgactacatgaacatgacteccegeegeceegggeceacecgcaageattaccagecetatgececac cacgcgacttegcagectategetecagagtgaagtteagcaggagegcagacgececegegtaccageaggges agaaccagctctataacgagctceaatetaggacgaagagaggagtacgatattttugacaagagacgtagecgga acccetgagataggggggaaagecgagaaggaagaaccctraggaaggcctatTcaatgaactgcagaaagataa gatggceggagacctTcagtgagattaggataaaaggegagegecggaggggcaaggggacacgatgagoecttiTce aggggctcagtacagccaccaaggacacctTegacgccctteacatagcaggecetgcececetegetaa [SEQ ID NO: 44] CONSTRUCTION D12
[0252] [0252] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (e.g., a human CD19 polypeptide), a transmembrane domain, and a hinge / spacer region derived from a polypeptide CD28, an intracellular signaling domain comprising a modified CD37 polypeptide (for example, a modified human CD37 polypeptide), and a co-stimulatory signaling region comprising a CD28 polypeptide (for example, a human CD28 polypeptide), wherein the CD36 polypeptide modified comprises a natural ITAM3 and does not comprise an ITAM1 (natural or modified), an ITAM 2 (natural or modified), a BRS1 (natural or modified), a BRS2 (natural or modified), or a BRS3 (natural or modified) . In certain modalities, the CAR is called “D12”. In certain embodiments, the CAR (for example, D12) comprises an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98% , about 99% or about 100% homologous to the amino acid sequence shown in SEQ ID NO: 45, which is provided as follows. SEQ ID NO: 45 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQOGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTVSSGGGGSGSGGESGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRAAAIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII
[0253] [0253] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 45 is shown in SEQ ID NO: 46, which is provided as follows.
[0254] [0254] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (e.g., human CD19 polypeptide), a transmembrane domain, and a hinge / spacer region derived from a CD28 polypeptide , an intracellular signaling domain comprising a modified CD37 polypeptide (e.g., a modified human CD37 polypeptide) comprising ITAM1I, BRS1 and an ITAM2, ITAM3, BRS2 and BRS3 deletion, and a co-stimulatory signaling region comprising a CD28 polypeptide ( for example, a human CD28 polypeptide), wherein the modified CD37 polypeptide comprises a natural ITAM1 and a natural BRS1, and does not comprise a ITAM2 (natural or modified), an ITAM3 (natural or modified), a BRS2 (natural or modified) , or a BRS3 (natural or modified). In certain modalities, the CAR is called “D23”. In certain embodiments, the CAR (for example, D23) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the amino acid sequence shown in SEQ ID NO: 47, which is provided as follows. SEQ ID NO: 47 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTIVSSGGGGSCSSGESGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOQSKDLADYFCQQYNRYPYTSGGGTKLEIKRAAAIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII
[0255] [0255] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 47 is shown in SEQ ID NO: 48, which is provided as follows.
[0256] [0256] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (e.g., a human CD19 polypeptide), a transmembrane domain, and a hinge / spacer region derived from a polypeptide CD28, an intracellular signaling domain comprising a modified CD36 polypeptide (for example, a modified human CD36 polypeptide) comprising a natural ITAM3, a natural BRS1, a natural BRS2, a natural BRS3, a variation of ITAM1 with two mutations with loss of function , and a variation of ITAM2 with two loss-of-function mutations, and a co-stimulatory signaling region comprising a CD28 polypeptide (for example, a human CD28 polypeptide). In certain modalities, the CAR is called “XX3”. In certain embodiments, the CAR (for example, XX3) comprises an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98% , about 99% or about 100% homologous to the amino acid sequence shown in SEQ ID NO: 49, which is provided as follows. SEQ ID NO: 49 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQOGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTVSSGGGGSGGGGSGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQASPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRAAAIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADA
[0257] [0257] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 49 is shown in SEQ ID NO: 50, which is provided as follows. atggcteteccagtgactgccectactgacttecectagegettetectacatacagaggtaaagetgcage agtctagggctaagctagtgaggacctagatecteagigaagatttcctacaagacttctagctatacattcagtagectact ggatgaactgggtgaagcagaggcctagacagggtcttaagitggattggacagatttatcctagagatggtgatacta actacaatggaaagttcaagggteaagecacactgactgcagacaaatcctecagcacagectacatgcageteag cggccetaacatctgaggactctacgagtcetatttetatacaagaaagaccattagtteggtagtagatttctacttigactact ggggccaagggaccacgagteacegtetecteaggtagaggtagatcaggtagaggtagatctagtagaggatagatc tgacattgagctcacccagtetecaaaattcatatecacateagtaggagacagggteagegtcacetgcaaggeca gtcagaatgtaggtactaatgtagcctaggtatcaacagaaaccaggacaatctectaaaccactgatttacteggcaa ccectaceggaacagtagagteccetgategettcacaggcagtggatctgggacagatttcacteteaccateactaacat gcagtctaaagacttggcagactatttetgteaacaatataacaggtatcegtacacgtecggaggggggaccaaget ggagatcaaacgggcggcegcreaattgaagttatatatcctectecttacctagacaatgagaagagcaatggaacca ttatccatgtgaaagggaaacacctttgtecaagtecectattteceggaccttetaageccettttaggtactagtagtagtt ggtagagtccetagettgctatagcttgctagtaa cagtagoectttattattttetaggtaaggagtaagaggagcaggcte ctgcacagtgactacatgaacatgactceccegecgeceegggeceacecgeaageattaccagecetatgeececa cacgcgacttegcagectategetecagagtgaagttragcaggagegeagacgececegegtaceageaggges agaaccagctctTtaacgagcteaatetaggacgaagagaggagtT cgatgattttggacaagagacgtagecagg acccetgagataggggggaaagecgagaaggaagaacccttraggaaggcctatTcaatgaactgcagaaagataa gatggcggagacctTcagtgagattaggataaaaggegagegecggaggggcaagggacacgatagectttace agggtctceagtacagccaccaaggacacctacgacgccctteacatgcaggeccetgeeeecetegetaa [SEQ ID NO: 50] X23 CONSTRUCTION
[0258] [0258] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (e.g., a human CD19 polypeptide), a transmembrane domain, and a hinge / spacer region derived from a polypeptide CD28, an intracellular signaling domain comprising a modified CD36 polypeptide (for example, a modified human CD36 polypeptide) comprising a natural ITAM2, a natural ITAM3, a natural BRS1, a natural BRS2, a natural BRS3, and a variation of ITAM1 with two loss-of-function mutations, and a co-stimulatory signaling region comprising a CD28 polypeptide (e.g., a human CD28 polypeptide). In certain modalities, the CAR is called “X23”. In certain embodiments, the CAR (for example, X23) comprises an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98% , about 99% or about 100% homologous to the amino acid sequence shown in SEQ ID NO: 51, which is provided as follows. SEQ ID NO: 51 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQOGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTIVSSGGGESGGGESGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRAAAIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADA
[0259] [0259] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 51 is shown in SEQ ID NO: 52, which is provided as follows.
[0260] [0260] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (for example, a human CD19 polypeptide), a transmembrane domain and a hinge / spacer region derived from a polypeptide CD28, an intracellular signaling domain comprising a modified CD36 polypeptide (for example, a modified human CD36 polypeptide) comprising a natural ITAM2, a natural BRS1, a natural BRS2, a natural BRS3, a variation of ITAM1 with two loss-of-function mutations , and a variation of ITAM3 with two loss-of-function mutations, and a co-stimulatory signaling region comprising a CD28 polypeptide (for example, a human CD28 polypeptide). In certain modalities, the CAR is called “X2X”. In certain embodiments, the CAR (for example, X2X) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the amino acid sequence shown in SEQ ID NO: 53, which is provided as follows. SEQ ID NO: 53 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQOGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTIVSSGGGGSGGGESGGGGESDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRAAAIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADA
[0261] [0261] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 53 is shown in SEQ ID NO: 54, which is provided as follows. atggctcteccagtgactgccecetactgcttcecetagegettctectacatacagaggatgaagetgcage agtctggggctgagctagtigaggcctagatecteagigaagatttectacaaggcttetagctatgcattcagtagctact ggatgaactgggtgaagcagaggcctagacagggtcttgagitggattggacagatttatcctagagatggtgatacta actacaatggaaagttcaagggtceaagecacactgactgcagacaaatcctecagcacagectacatagcageteag cggcctaacatctgaggactctacgagtcetatttetatacaagaaagaccattagtteggtagtagatttctactttgactact ggggccaagggaccacagteacegtetecteaggtagaggtagatcaggtagaggatagatctagtagagatagatc tgacattgagctcacccagtetecaaaattcatgtecacatcagtaggagacagggteagegteacetagcaaggeca gtcagaatgtaggtactaatgtagcctagtatcaacagaaaccaggacaatctectaaaccactgatttacteggcaa cctaceggaacagtagagtecetgategettecacaggcagtggatctaggacagatttcacteteaceateactaacat gcagtctaaagacttggcagactatttetateaacaatataacaggtatccgtacacgteeggagggggagaccaaget ggagatcaaacgggcggcegcaattgaagttatatatcctectecttacetagacaatagagaagagcaatggaacca ttatccatgtgaaagggaaacacctttatecaagtecectattteceggaccttetaageccttttaggtactagtagtggtt ggtagagtcctagettgctatagcttgctagtaacagt agoectttattattttetaggtagaggagtaagaggagcaggcte ctgcacagtgactacatgaacatgactcccegeegeceegggeceacecgcaageattaccagecetatgececac cacgcgacttegcagcectategetecagagtgaagtttrcagcaggagegeagacgececegegtaceageaggges agaaccagctctTtaacgagcteaatcetaggacgaagagaggagtT cgatgattttggacaagagacgtagecagg acccectgagataggggggaaagecgagaaggaagaaccctcraggaaggcctatacaatgaactgcagaaagataa gatggcggaggcctacagtgagattaggatagaaaggegagegecggaggggcaaggggcacgatagcectttTce aggggctcagtacagccaccaaggacacctTcegacgccecttcacatgcaggeccetaceceectegetaa [SEQ ID NO: 54] CONSTRUCTION 12X
[0262] [0262] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (for example, a human CD19 polypeptide), a transmembrane domain and a hinge / spacer region derived from a polypeptide CD28, an intracellular signaling domain comprising a modified CD36 polypeptide (for example, a modified human CD36 polypeptide) comprising a natural ITAM1, a natural ITAM2, a natural BRS1, a natural BRS2, a natural BRS3, and a variation of ITAM3 with two loss-of-function mutations, and a co-stimulatory signaling region comprising a CD28 polypeptide (e.g., a human CD28 polypeptide). In certain modalities, the CAR is called “12X”. In certain embodiments, the CAR (for example, 12X) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the amino acid sequence shown in SEQ ID NO: 55, which is provided as follows. SEQ ID NO: 55 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQOGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTVSSGGGGSGGCGESGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRAAAIEVMY PPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADA
[0263] [0263] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 55 is shown in SEQ ID NO: 56, which is provided as follows.
[0264] [0264] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (e.g., human CD19 polypeptide), a transmembrane domain, and a hinge / spacer region derived from a CD28 polypeptide , an intracellular signaling domain comprising a modified CD36 polypeptide (e.g., a modified human CD36 polypeptide) comprising ITAM1, ITAM2, BRS1, BRS2, and an ITAM3 deletion and a portion of BRS3, and a co-stimulatory signaling region comprising a CD28 polypeptide (for example, a human CD28 polypeptide), wherein the modified CD36 polypeptide comprises a natural ITAM1, a natural ITAM2, a natural BRS1 and a natural BRS2, and does not comprise a ITAM3 (natural or modified) or a natural BRS3 . In certain modalities, the CAR is called “D3”. In certain embodiments, the CAR (for example, D3) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about
[0265] [0265] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 57 is shown in SEQ ID NO: 58, which is provided as follows.
[0266] [0266] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (e.g., a human CD19 polypeptide), a transmembrane domain, and a hinge / spacer region derived from a polypeptide CD166, an intracellular signaling domain comprising a modified CD36 polypeptide (for example, a modified human CD36 polypeptide) comprising a natural ITAM1, a natural ITAM2, a natural ITAM3, a natural BRS1, a natural BRS2 and a natural BRS3, and a region co-stimulatory signaling system comprising a CD28 polypeptide (for example, a human CD28 polypeptide). In certain modalities, the CAR is called “19-166-282”. In certain embodiments, the CAR (for example, 19-166-28z) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95% at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the amino acid sequence shown in SEQ ID NO: 59 , which is provided as follows. SEQ ID NO: 59 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTIVSSGGGGSGSGGGESGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRNQLERTV NSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKK RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRKRVKFSRSADAPAYQ
[0267] [0267] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 59 is shown in SEQ ID NO: 60, which is provided as follows.
[0268] [0268] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (for example, a human CD19 polypeptide), a transmembrane domain and a hinge / spacer region derived from a polypeptide CD166, an intracellular signaling domain comprising a modified CD36 polypeptide (for example, a modified human CD36 polypeptide) comprising a natural ITAM1, a natural BRS1, a natural BRS2, a natural BRS3, a variation of ITAM2 with two mutations with loss of function , and a variation of ITAM3 with two loss-of-function mutations, and a co-stimulatory signaling region comprising a CD28 polypeptide (for example, a human CD28 polypeptide). In certain modalities, the CAR is called “19-166-28z2 1XX”. In certain embodiments, the CAR (for example, 19-166-28z 1XX) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95 %, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the amino acid sequence shown in SEQ ID NO: 61, which is provided as follows. SEQ ID NO: 61 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQOSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQOGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTIVSSGGGGSGGGGESGGGGSDIEL TQASPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRNQLERTV NSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKK RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRKRVKFSRSADAPAYQ
[0269] [0269] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 61 is shown in SEQ ID NO: 62, which is provided as follows.
[0270] [0270] In certain embodiments, a CAR currently described comprises an extracellular antigen binding domain that binds to a CD19 polypeptide (e.g., human CD19 polypeptide), a transmembrane domain, and a hinge / spacer region derived from a CD166 polypeptide , an intracellular signaling domain comprising a modified CD36 polypeptide (e.g., a modified human CD36 polypeptide) comprising ITAM1, BRS1 and an elimination of ITAM2, ITAM3, BRS2 and BRS3, and a costimulatory signaling region comprising a CD28 polypeptide ( for example, a human CD28 polypeptide), wherein the modified CD36 polypeptide comprises a natural ITAM1 and a natural BRS1, and does not comprise a ITAM2 (natural or modified), an ITAM3 (natural or modified), a BRS2 (natural or modified) , or a BRS3 (natural or modified). In certain modalities, the CAR is called “19-166-28z D23”. In certain embodiments, the CAR (for example, 19-166-28z D23) comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95 %, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% homologous or identical to the amino acid sequence shown in SEQ ID NO: 63, which is provided as follows. SEQ ID NO: 63 includes a CD8 main sequence at amino acids 1 to 18, and is capable of binding to CD19 (for example, human CD19). MALPVTALLLPLALLLHAEVKLQQSGAELVRPGSSVKISCKASGYAFSSY WMNWVKQRPGQGLEWIGQIYPGDGDTNYNGKFKGQATLTADKSSSTAYMQLSGL TSEDSAVYFCARKTISSVVDFYFDYWGQGTTVTIVSSGGGGSGGGGESGGGGSDIEL TQSPKFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKPLIYSATYRNSGVP DRFTGSGSGTDFTLTITNVOSKDLADYFCQQYNRYPYTSGGGTKLEIKRNQLERTV NSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKK
[0271] [0271] An exemplary nucleic acid sequence encoding the amino acid sequence of SEQ ID NO: 63 is shown in SEQ ID NO: 64, which is provided as follows.
[0272] [0272] The subject in question currently described provides immunoresponsive cells comprising one or more CARs described herein. In certain embodiments, CAR is able to activate the immunoresponsive cell. In certain embodiments, CAR is expressed from an endogenous locus (for example, TRAC).
[0273] [0273] In certain embodiments, immunoresponsive cells comprising one or more CARs currently described exhibit better therapeutic efficiency compared to control cells. In certain embodiments, immunoresponsive cells comprising one or more CARs currently described exhibit similar cytotoxic effects compared to control cells. In certain embodiments, immunoresponsive cells comprising one or more CARs currently described exhibit better cell accumulation when administered to a subject, compared to control cells. In certain embodiments, immunoresponsive cells comprising one or more CARs currently described exhibit decreased cell exhaustion when administered to a subject, compared to control cells. Immunoresponsive cell exhaustion markers include, but are not limited to, TIM3, LAG3 and PD1. In certain embodiments, immunoresponsive cells comprising a currently described CAR maintain a larger contingent of immune memory cells when administered to a subject, compared to control cells. Immune memory cell markers include, but are not limited to, CD62L and CD45RA. In certain embodiments, immunoresponsive cells comprising one or more CARs currently described secrete similar levels of cytokines compared to control cells. In certain embodiments, cytokines secreted by immunoresponsive cells include, but are not limited to, TNFα, IFNy and I | L2. In certain embodiments, the control cells comprise a CAR comprising an intracellular signaling domain comprising a modified CD37 polypeptide, wherein the modified CD36 polypeptide comprises all natural ITAM1-3 and all natural BRS1-3.
[0274] [0274] In certain embodiments, the immunoresponsive cell comprises two or more CARs. In certain embodiments, at least one of the two or more CARs is a CAR described here. In certain embodiments, the immunoresponsive cell comprises two CARs. In certain embodiments, the immunoresponsive cell comprises three CARs.
[0275] [0275] In certain embodiments, the immunoresponsive cell comprises a) a first CAR comprising a first extracellular antigen binding domain that binds to a first antigen, a first transmembrane domain, and a first intracellular signaling domain comprising modified CD37 polypeptide ( for example, a modified CD37 polypeptide described herein); and b) a second CAR comprising a second extracellular antigen binding domain that binds a second antigen, a second transmembrane domain, and a second intracellular signaling domain. In certain embodiments, the first CAR additionally comprises a first hinge / spacer region. In certain embodiments, the second CAR additionally comprises a second hinge / spacer region.
[0276] [0276] In certain embodiments, the second intracellular signaling domain comprises a modified CD37 polypeptide (for example, a modified CD37 polypeptide described herein). In certain embodiments, the second intracellular signaling domain comprises a natural CD37 polypeptide. In certain embodiments, the modified CD37 polypeptide comprised in the second intracellular signaling domain is the same as the modified CD36 polypeptide comprised in the first intracellular signaling domain. In certain embodiments, the modified CD37 polypeptide comprised in the second intracellular signaling domain is different from the modified CD37 polypeptide comprised in the first intracellular signaling domain. In certain embodiments, the modified CD36 polypeptides are selected from the group consisting of CD36 polypeptide comprising a natural ITAM, CD376 polypeptides comprising two natural ITAMs, CD36 polypeptides comprising three natural ITAMs, CD36 polypeptides comprising a variation of ITAM described herein, CD36 polypeptides comprising two variations of ITAM described herein, CD37 polypeptides comprising a natural BRS region, CD36 polypeptides comprising two natural BRS regions, CD36 polypeptides comprising three natural BRS regions, CD37 polypeptides that lose all or part of ITAM1, ITAM2, ITAM3 and / or any portion thereof , and any combination thereof.
[0277] [0277] In certain embodiments, the two or more CARs comprised in the immunoresponsive cell are different (for example, the first CAR is different from the second CAR). In certain embodiments, the two or more CARs comprised in the immunoresponsive cell are the same (for example, the first CAR is the same as the second CAR).
[0278] [0278] In certain modalities, the two or more CARs bind to different antigens (for example, the first antigen is different from the second antigen).
[0279] [0279] In certain embodiments, the two or more CARs comprise different intracellular signaling domains (for example, the first intracellular signaling domain is different from the second intracellular signaling domain). In certain embodiments, the two or more CARs comprise the same intracellular signaling domain (for example, the first intracellular signaling domain is the same as the second intracellular signaling domain).
[0280] [0280] In certain embodiments, the intracellular signaling domains of the two or more CARs comprise different co-stimulatory signaling regions. In certain embodiments, the co-stimulatory signal regions are selected from the group consisting of a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP-10 polypeptide, a CD27 polypeptide, a CD40 / polypeptide My88, an NKGD2 peptide, and combinations thereof. In certain embodiments, the intracellular signaling domains of the two or more CARs comprise the same co-stimulatory signaling region.
[0281] [0281] In certain embodiments, the immunoresponsive cell comprises two, three or more CARs currently described. In certain embodiments, each of the CARs intracellular signaling domains is independently selected from the group consisting of the 19287, 197, 1XX, X2X, XX3, X23, 12X, D3, D12 and D23 intracellular signaling domains.
[0282] [0282] The selection of the CARs comprised in the cell may depend on the densities of the antigens targeted by the CARs, the sum of all ITAMs, the distance between each ITAM, the transmembrane domain of CARs, and / or the co-stimulatory signaling domain of CARs, since precedents can determine the extent of activation signals produced by each CAR.
[0283] [0283] In certain embodiments, the immunoresponsive cell comprises two CARs, where the first CAR comprises a first intracellular signaling domain, and the second CAR comprises a second intracellular signaling domain. In certain embodiments, each of the first and second intracellular signaling domains is selected from the group consisting of the 19287, 196, 1XX, X2X, XX3, 12X, X23, D3, D12 and D23 intracellular signaling domains.
[0284] [0284] In certain embodiments, the first intracellular signaling domain is the same as the second intracellular signaling domain. In certain embodiments, each of the first and second intracellular signaling domains is the 1XX intracellular signaling domain. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the 1XX intracellular signaling domain and the D23 intracellular signaling domains. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the 1XX intracellular signaling domain and the XX3 intracellular signaling domain. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the D23 intracellular signaling domain and the XX3 intracellular signaling domain. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the 1XX intracellular signaling domain and the X2X intracellular signaling domain. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the XX intracellular signaling domain and the D12 intracellular signaling domain. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the 1XX intracellular signaling domain and the 12X intracellular signaling domain. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the 1XX intracellular signaling domain and the D3 intracellular signaling domain. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the X2X intracellular signaling domain and the X2X intracellular signaling domain. In certain embodiments, the first intracellular signaling domain and the second intracellular signaling domain are the 19287 intracellular signaling domain and the 1XX intracellular signaling domain.
[0285] [0285] In certain embodiments, the first intracellular signaling domain comprises or exhibits a variation of ITAM2 and a variation of ITAM3, and the second intracellular signaling domain comprises or exhibits an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof. In certain embodiments, the first intracellular signaling domain comprises or exhibits a variation of ITAM2 and a variation of ITAM3, and the second intracellular signaling domain comprises or exhibits a variation of ITAM1 and a variation of ITAM2.
[0286] [0286] In certain modalities, the sum of natural ITAMs included in the two CARs is not more than about five, not more than about four, not more than about three, or not more than about two.
[0287] [0287] In certain embodiments, the immunoresponsive cell comprises three CARs, where the first CAR comprises a first intracellular signaling domain, the second CAR comprises a second intracellular signaling domain, and the third CAR comprises a third intracellular signaling domain. In certain embodiments, each of the first, second and third intracellular signaling domains is independently selected from the group consisting of the 19287, 196, 1XX, X2X, XX3, X23, 12X, D3 D12 and D23 intracellular signaling domains.
[0288] [0288] In certain embodiments, the first intracellular signaling domain, the second intracellular signaling domain, and the third intracellular signaling domain are the 1XX intracellular signaling domain, the D23 intracellular signaling domain, and the signaling domain intracellular of XX3. In certain embodiments, the first intracellular signaling domain, the second intracellular signaling domain, and the third intracellular signaling domain are the D23 intracellular signaling domain, the D23 intracellular signaling domain, and the XX3 intracellular signaling domain . In certain embodiments, the first intracellular signaling domain, the second intracellular signaling domain, and the third intracellular signaling domain are the D23 intracellular signaling domains, the XX3 intracellular signaling domain, and the XX3 intracellular signaling domain . In certain embodiments, the first intracellular signaling domain, the second intracellular signaling domain, and the third intracellular signaling domain are the XX3 intracellular signaling domain, the XX3 intracellular signaling domain, and the XX3 intracellular signaling domain. In certain embodiments, the first intracellular signaling domain, the second intracellular signaling domain, and the third intracellular signaling domain are the 1XX intracellular signaling domain, the 1XX intracellular signaling domain, and the 1XX intracellular signaling domain.
[0289] [0289] In certain embodiments, the first intracellular signaling domain comprises or presents a variation of ITAM2 and a variation of ITAM3, the second intracellular signaling domain comprises or presents an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof, and the third intracellular signaling domain comprises or exhibits a variation of ITAM1 and a variation of ITAM2. In certain embodiments, the first intracellular signaling domain comprises or has an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof, the second intracellular signaling domain comprises or presents an elimination of ITAM2 or a portion of the same, and an elimination of ITAM3 or a portion thereof, and the third intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM2. In certain embodiments, the first intracellular signaling domain comprises or exhibits an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof, the second intracellular signaling domain comprises or exhibits a variation of ITAM1I and a variation of ITAM2, and the third domain of intracellular signaling comprises or presents a variation of ITAM1 and a variation of ITAM2. In certain embodiments, the first intracellular signaling domain comprises or exhibits a variation of ITAM1 and a variation of ITAM2, the second intracellular signaling domain comprises or exhibits a variation of ITAM1 and a variation of ITAM2, and the third intracellular signaling domain comprises or has a variation of ITAM1 and a variation of ITAM2.
[0290] [0290] In certain modalities, the sum of natural ITAMs included in the three CARs is not more than about five, not more than about four, not more than about three.
[0291] [0291] In certain modalities, the targets of the CARs are different from each other.
[0292] [0292] The immunoresponsive cells of the subject in question currently described may be cells of the lymphoid lineage. The lymphoid lineage, comprising B, T cells and natural killers (NK), provides the production of antibodies, regulation of the cellular immune system, detection of external agents in the blood, detection of cells external to the host and the like. Non-limiting examples of immunoresponsive cells of the lymphoid lineage include T cells, natural killer cells (NK), embryonic stem cells and pluripotent stem cells (for example, those from which lymphoid cells can be differentiated). T cells can be lymphocytes that mature in the thymus and are mainly responsible for cell-mediated immunity. T cells are involved in the adaptive immune system. The T cells of the subject in question currently described can be any type of T cells including, but not limited to, helper T cells, cytotoxic T cells, memory T cells (including central memory T cells, memory T cells as a stem cell ( or memory T cells as a stem), and two types of effector memory T cells: for example, Tem cells and Temra cells, regulatory T cells (also known as suppressor T cells), natural killer T cells, invariable T cells associated with mucosa, and y T cells. Cytotoxic T cells (CTL or exterminating T cells) are a subset of T lymphocytes capable of inducing the death of infected tumor or somatic cells. The patient's own T cells can be genetically modified to target specific antigens through the introduction of a CAR. In certain embodiments, the immunoresponsive cell is a T cell. The T cell can be either a CD4 * T cell or a CD8 * T cell. alities, the T cell is a CD4 * T cell. In certain embodiments, the T cell is a CD8 * T cell.
[0293] [0293] —Natural exterminating cells (NK) can be lymphocytes, which are part of cell-mediated immunity and act during the innate immune response. the cells
[0294] [0294] The types of human lymphocytes of the subject in question currently described include, without limitation, peripheral donor lymphocytes, for example, those described in Sadelain, M., et al. 2003 Nat Rev Cancer 3: 35-45 (which describe peripheral donor lymphocytes genetically modified to express CARs), in Morgan, R.A., et al. 2006 Science 314: 126-129 (which describe peripheral donor lymphocytes genetically modified to express a full-size tumor-recognizing T cell receptor antigen, comprising heterodimer a and B), in Panelli, M.C., et al. 2000 J Immunol 164: 495-504; Panelli, M.C., et al. 2000 J Immunol 164: 4382-4392 (which describe lymphocyte cultures derived from tumor infiltrating lymphocytes (TILs) in tumor biopsies), and in Dupont, J., et al. 2005 Cancer Res 65: 5417-5427; Papanicolaou, G.A., et al. 2003 Blood 102: 2498-2505 (which selectively describe in vitro expanded antigen-specific peripheral blood leukocytes that employ artificial antigen presenting cells (AAPCs), or pulsed dendritic cells). Immunoresponsive cells (eg, T cells) can be autologous, non-autologous (eg, allogeneic), or derived in vitro from genetically modified stem or progenitor cells.
[0295] [0295] The currently described immunoresponsive cells are capable of modulating the tumor microenvironment. Tumors have a microenvironment that is hostile to the host's immune response, which involves a series of mechanisms by malignant cells to protect them from immune recognition and elimination. This “hostile tumor microenvironment” comprises a variety of immune suppressive factors, including infiltrating regulatory CD4 * T cells (Tregs), myeloid derived suppressor cells (MDSCs), tumor associated macrophages (TAMs), immune suppressive cytokines including TGF-B, and expression of targeted ligands for immune suppressive receptors expressed by activated T cells (CTLA-4 and PD-1). These immune suppression mechanisms play a role in maintaining tolerance and suppressing inappropriate immune responses, however, in the tumor microenvironment, these mechanisms prevent an efficient anti-tumor immune response. Collectively, these immune suppressive factors can induce both marked anergy and apoptosis of T cells modified by CAR transferred in an adoptive manner, upon encounter with targeted tumor cells.
[0296] [0296] The unpurified source of CTLs can be any known in the art, such as the bone marrow, fetal, neonatal or adult cell source, or other hematopoietic, for example, fetal liver, peripheral blood or umbilical cord blood. Various techniques can be employed to separate the cells. For example, negative selection methods can initially remove non-CTLs. mAbs are particularly used to identify markers associated with particular cell lines, and / or stages of differentiation for both positive and negative selections.
[0297] [0297] A large proportion of terminally differentiated cells can be removed initially by relatively rough separation. For example, separation with magnetic spheres can be used initially to remove large numbers of irrelevant cells. In certain embodiments, at least about 80%, in general at least 70% of the total hematopoietic cells will be removed before cell isolation.
[0298] [0298] Separation procedures include, but are not limited to, density gradient centrifugation; reboot; coupling to particles that modify cell density; magnetic separation with antibody-coated magnetic beads; affinity chromatography; cytotoxic agents attached to, or used in conjunction with, an mAb including, but not limited to, complement and cytotoxins; and successive cycles of selection with antibody attached to a solid matrix, for example, plate, chip, elutriation or any other convenient technique.
[0299] [0299] Techniques for separation and analysis include, but are not limited to, flow cytometry, which can have varying degrees of sophistication, for example, a plurality of color channels, obtuse light scattering and reduced angle detection channels, channels impedance.
[0300] [0300] Cells can be selected against dead cells using dyes associated with dead cells, such as propidium iodide (PI). In certain embodiments, cells are collected in a medium comprising 2% fetal bovine serum (FCS) or 0.2% bovine serum albumin (BSA), or any other suitable medium, for example, sterile isotonic.
[0301] [0301] The genetic modification of an immunoresponsive cell (for example, a T cell or an NK cell) can be carried out by transducing a substantially homogeneous cell composition with a recombinant DNA construct. In certain embodiments, a retroviral vector (both gamma-retroviral and lentiviral) is used to introduce the construction of DNA into the cell. For example, a polynucleotide encoding a CAR can be cloned into a retroviral vector and expression can be directed from its endogenous promoter, from the long retroviral terminal repeat, or from a promoter specific to a target cell type of interest. Non-viral vectors can be used equally.
[0302] [0302] For the initial genetic modification of an immunoresponsive cell to include a CAR, a retroviral vector is generally employed for transduction, however, any other suitable viral vector or non-viral delivery system can be used. CAR can be constructed with an auxiliary molecule (for example, a cytokine) in a single, multicistronic expression cassette, in multiple expression cassettes of a single vector, or in multiple vectors. Examples of elements that create polycistronic expression cassettes include, but are not limited to, various internal viral and non-viral ribosome sites (IRES, for example, FGF-1 IRES, FGF-2 IRES, VEGF IRES, IGF-II IRES, NF- «B IRES, RUNX1 IRES, p53 IRES, Hepatitis A IRES, Hepatitis C IRES, Pestivirus IRES, Aftovirus IRES, Picornavirus IRES, Poliovirus IRES and Encephalomyocarditis Virus IRES) and cleavable linkers (for example , 2A peptides, for example, P2A, T2A, E2A and F2A peptides). In certain embodiments, any vector or CAR described herein can comprise a P2A peptide comprising the amino acid sequence of GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 107). Combinations of retroviral vector and an appropriate packaging lineage are also suitable, where the capsid proteins will be functional to infect human cells. Several amphotropic virus-producing cell lines are known including, but not limited to, PA12 (Miller, et al. (1985) Mol. Cell. Biol. 5: 431-437); PA317 (Miller, et al. (1986) Mol. Cell. Biol. 6: 2895-2902); and CRIP (Danos, et a /. (1988) Proc. Natl. Acad. Sci. USA 85: 6460-6464). Non-amphotropic particles are also suitable, for example, pseudotyped particles with a VSVG, RD114 or GALV envelope and any other known in the art.
[0303] [0303] Possible methods of transduction also include direct co-culture of cells with producer cells, for example, by the method of Bregni, et a /. (1992) Blood 80: 1418-1422, or growing with viral supernatant alone, or concentrated vector stocks with or without appropriate growth factors and polycations, for example, by the method of Xu, et al. (1994) Exp. Hemat. 22: 223-230; and Hughes, et al. (1992) J. Clin. Invest. 89: 1817.
[0304] [0304] Other viral transduction vectors can be used to modify an immunoresponsive cell. In certain modalities, the classified vector exhibits high infection efficiency and stable integration and expression (see, for example, Cayouette et al., Human Gene Therapy 8: 423-430, 1997; Kido et al., Current Eye Research 15: 833 -844, 1996; Bloomer et al., Journal of Virology 71: 6641-6649, 1997; Naldini et al., Science 272: 263-267, 1996; and Miyoshi et al., Proc. Natl. Acad. Sci. States 94: 10319, 1997). Other viral vectors that can be used include, for example, adenoviral, lentiviral and adeno-associated viral vectors, vaccinia virus, a bovine papilloma virus, or a herpes virus, such as Epstein-Barr virus (see also, for example, vectors Miller, Human Gene Therapy 15-14, 1990; Friedman, Science 244: 1275-1281, 1989; Eglitis et al., BioTechniques 6: 608- 614, 1988; Tolstoshev et al., Current Opinion in Biotechnology 1: 55- 61, 1990; Sharp, The Lancet 337: 1277-1278, 1991; Cornetta etal., Nucleic Acid Research and Molecular Biology 36: 311-322, 1987; Anderson, Science 226: 401-409, 1984; Moen, Blood Cells 17 : 407-416, 1991; Miller et al., Biotechnology 7: 980-990, 1989; LeGal La
[0305] [0305] Non-viral approaches can also be used for genetic modification of an immunoresponsive cell. For example, a nucleic acid molecule can be introduced into an immunoresponsive cell by administering nucleic acid in the presence of lipofection (Feigner et al., Proc. Natl. Acad. Sci. United States 84: 7413, 1987; Ono et al., Neuroscience Letters 17: 259, 1990; Brigham et al., Am. J. Med. Sci. 298: 278, 1989; Staubinger et al., Methods in Enzymology 101: 512, 1983), asialo-orosomucoid-polylysine conjugation (Wu et al., Journal of Biological Chemistry 263: 14621, 1988; Wu et al., Journal of Biological Chemistry 264: 16985, 1989), or by microinjection under surgical conditions (Wolff et al., Science 247: 1465, 1990 ). Other non-viral means for gene transfer include in vitro transfection using calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes can also be potentially beneficial for releasing DNA into a cell. The transplantation of normal genes into a subject's affected tissues can also be performed by transferring a normal nucleic acid into an ex vivo cultivable cell type (for example, an autologous or heterologous primary cell, or progeny thereof), after which the cell (or their descendants) is injected into a targeted tissue, or is injected systemically. Recombinant receptors can also be derived or obtained using transposases or targeted nucleases (e.g., zinc finger nucleases, meganucleases, or TALE, CRISPR nucleases). Transient expression can be obtained by electroporation of RNA.
[0306] [0306] The system of short palindromic repetitions grouped regularly interspersed (CRISPR) is a tool for editing genomes discovered in prokaryotic cells. When used to edit the genome, the system includes Cas9 (a protein capable of modifying DNA using RNAcr as its guide), RNA CRISPR (RNAcr contains the RNA used by Cas9 to guide you to the correct section of
[0307] [0307] A zinc finger nuclease (ZFN) is an artificial restriction enzyme, which is generated by combining a zinc finger DNA binding domain with a DNA cleavage domain. A zinc finger domain can be genetically modified to target specific DNA sequences that allow a zinc finger nuclease to target the desired sequences in the genomes. The DNA binding domains of individual ZFNs typically contain a plurality of individual zinc finger repeats, and can each recognize a plurality of base pairs. The most common method for generating a new zinc finger domain is to combine smaller zinc finger “modules” of known specificity. The most common cleavage domain in ZFNs is the non-specific cleavage domain of Fokl type II restriction endonucleases. Using endogenous homologous (HR) recombination machinery and a homologous RNA template that carries the CAR expression cassette, ZFNs can be used to insert the CAR expression cassette into the genome. When the targeted sequence is cleaved by ZFNs, the HR machinery searches for homology between the damaged chromosome and the homologous DNA template, and then copies the template sequence between the two broken ends of the chromosome, through which the Homologous DNA is integrated into the genome.
[0308] [0308] Transcription activator-type effector nuclear cells (TALEN) are restriction enzymes that can be genetically modified to cut specific DNA sequences. The TALEN system works on almost the same principles as ZFNs. They are generated by combining a transcriptional activator-binding DNA binding domain with a DNA cleavage domain. Transcription activator-type effectors (TALEs) are composed of 33-34 repeating amino acid motifs with two variable positions, which have strong recognition for specific nucleotides. By assembling arrangements of these TALEs, the TALE DNA binding domain can be genetically modified to bind to the desired DNA sequence, and thereby guide the nuclease to cut at specific locations in the genome. Expression of cDNA for use in polynucleotide therapy methods can be targeted from any suitable promoter (for example, human cytomegalovirus (CMV), simian virus 40 (SV40) or metallothionein promoters), and regulated by any element regulatory framework of appropriate mammal or intron (for example, the enhancer / promoter / intron 1a of the elongation factor). For example, if desired, enhancers known to preferentially target gene expression in specific cell types can be used to target expression of a nucleic acid. The enhancers used can include, without limitation, those that are characterized as specific tissue or cell enhancers. Alternatively, if a genomic clone is used as a therapeutic construct, regulation can be mediated by cognate regulatory sequences or, if desired, regulatory sequences derived from a heterologous source, including - any of the promoters or regulatory elements described above.
[0309] [0309] The resulting cells can be grown under conditions similar to those for unmodified cells, whereby the modified cells can be expanded and used for a variety of purposes.
[0310] [0310] Any targeted genome editing methods can be used to position CARs currently described in one or more endogenous loci of an currently described immunorresponding cell. In certain embodiments, a CRISPR system is used to release CARs currently described in one or more endogenous loci of an currently described immunoresponsive cell. In certain embodiments, zinc finger nucleases are used to release CARs currently described in one or more endogenous loci of a currently described immunorresponsive cell. In certain embodiments, a TALEN system is used to release CARs currently described in one or more endogenous loci of an currently described immunoresponsive cell.
[0311] [0311] Methods for releasing genome editing agents / systems may vary, depending on the need. In certain embodiments, the components of a selected genome editing method are released as DNA constructs in one or more plasmids. In certain embodiments, the components are released via viral vectors. Common delivery methods include, but are not limited to, electroporation, microinjection, gene gun, impalefection, hydrostatic pressure, continuous infusion, sonication, magnetofection, adeno-associated viruses, envelope protein pseudotyping, cis-acting elements and trans from competent replicating vectors, herpes simplex viruses and chemical vehicles (for example, oligonucleotides, lipoplexes, polymersomes, polyplexes, dendrimers, inorganic nanoparticles, and cell-penetrating peptides).
[0312] [0312] The positioning of a CAR currently described can be performed at any endogenous gene locus. In certain embodiments, the endogenous gene locus is a TRAC locus, a TRBC locus or a TRGC locus. In certain embodiments, the endogenous gene locus is a TRAC locus. In certain modalities, the positioning of the CAR interrupts or cancels the endogenous expression of a TCR.
[0313] [0313] Also included in the subject in question are currently described polypeptides CD19, CD8, CD28, CD37, CD40, 4-1BB, OX40, CD84, CD166, CD8a, CD8b, ICOS, ICAM-1, CD27, MY88, NKGD2 and CTLAHA, or fragments thereof, that are modified in such a way as to improve their antineoplastic activity when expressed in an immunoresponsive cell.
[0314] [0314] In addition to the full-length polypeptides, the subject in question currently described also provides fragments of any of the polypeptide or peptide domains described here. As used herein, the term "a fragment" means at least 5, 10, 13, or 15 amino acids. In certain embodiments, a fragment comprises at least 20 contiguous amino acids, at least 30 contiguous amino acids, or at least 50 contiguous amino acids. In certain embodiments, a fragment comprises at least 60 to 80, 100, 200, 300 or more contiguous amino acids. The fragments may be generated by methods known to those skilled in the art or may result from normal protein processing (for example, removal of amino acids from the nascent polypeptide that are not required for biological activity, or removal of amino acids by alternative mRNA splicing, or events alternative protein processing systems).
[0315] [0315] Non-protein analogues have a chemical structure designed to mimic the functional activity of a protein described here. Such analogs can exceed the physiological activity of the original polypeptide. Analogous design methods are well known in the art, and the synthesis of analogues can be performed according to such methods by modifying chemical structures, in such a way that the resulting analogs increase the anti-neoplastic activity of the original polypeptide, when expressed in a cell immunoresponsive. These chemical modifications include, but are not limited to, substituting alternative R groups and varying the degree of saturation at specific carbon atoms of a reference polypeptide. In certain embodiments, protein analogues are relatively resistant to degradation in vivo, resulting in a more prolonged therapeutic effect upon administration. Tests to measure functional activity include, but are not limited to, those described in the following examples
[0316] [0316] Compositions comprising the currently described immunoresponsive cells can be provided, systemically or directly, to a subject to induce and / or improve an immune response to an antigen, and / or treat and / or prevent a neoplasm, pathogen infection or infectious disease. In certain embodiments, the currently described immunoresponsive cells, or compositions comprising them, are injected directly into an organ of interest (for example, an organ affected by a neoplasm). Alternatively, the currently described immunoresponsive cells, or compositions comprising them, are provided indirectly to the organ of interest, for example, by administration to the circulatory system (for example, the tumor vasculature). Expansion and differentiation agents can be provided before, during or after administration of the cells or compositions to increase the production of T cells, NK cells, or CTL cells in vitro or in vivo.
[0317] [0317] The currently described immunoresponsive cells can be administered in any physiologically acceptable vehicle, usually intravascularly, although they can also be introduced into the bones or other convenient site, where the cells can find an appropriate site for regeneration and differentiation (for example, thymus ). In general, at least about | x 105 cells will be administered, eventually reaching around | x 10 * º or more. The immunoresponsive cells currently described can comprise a purified cell population. Those skilled in the art can easily determine the percentage of immunorresponding cells currently described in a population using several well-known methods, such as fluorescence-activated cell separation (FACS). The appropriate ranges of purity in populations comprising the currently described immunoresponsive cells are about 50
[0318] [0318] The currently described compositions can be pharmaceutical compositions comprising the currently described immunoresponsive cells, or their progenitors, and a pharmaceutically acceptable carrier. Administration can be autologous or heterologous. For example, immunoresponsive or progenitor cells can be obtained from one subject, and administered to the same subject or to a different compatible subject. Immunoresponsive cells derived from peripheral blood or its progeny (for example, derived in vivo, ex vivo or in vitro) can be administered via localized injection, including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration . During the administration of a therapeutic composition of the subject in question currently described (for example, a pharmaceutical composition comprising an immunorresponsive cell currently described), it can be formulated in a single injectable dosage form (solution, suspension, emulsion).
[0319] [0319] Compositions comprising the currently described immunoresponsive cells can be conveniently provided as sterile liquid preparations, for example, isotonic aqueous solutions, suspensions, emulsions, dispersions or viscous compositions, which can be buffered at a selected pH. Liquid preparations are usually easier to prepare than gels, other viscous compositions and solid compositions. In addition, liquid compositions are a little more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated in the appropriate viscosity range to provide longer contact periods with specific fabrics. Liquid or viscous compositions may comprise carriers, which may be a solvent or dispersion medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol and the like) and suitable mixtures of these.
[0320] [0320] Sterile injectable solutions can be prepared by incorporating the genetically modified immunoresponsive cells, in the required amount of the appropriate solvent, with various amounts of the other ingredients, if desired. Such compositions can be mixed with a suitable carrier, diluent or excipient, such as sterile water, physiological saline, glucose, dextrose or the like. The compositions can also be lyophilized. The compositions can contain auxiliary substances such as wetting agents, dispersants or emulsifiers (for example, methylcellulose), pH buffering agents, gelling agents or additives that improve viscosity, preservatives, flavoring agents, colorings and the like, depending on the route of administration and the desired preparation. Standard texts, such as “REMINGTON'S PHARMACEUTICAL SCIENCE”, 17th edition, 1985, incorporated by reference, can be consulted to prepare suitable preparations, without undue experimentation.
[0321] [0321] Various additives that improve the stability and sterility of the compositions, including antimicrobial preservatives, antioxidants, chelating agents and buffers, can be added. The prevention of the action of microorganisms can be guaranteed by several antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid and the like. The prolonged absorption of the injectable pharmaceutical form can be caused by the use of agents that delay absorption, for example, aluminum monostearate and gelatin. According to the subject in question currently described, however, any vehicle, diluent or additive used would have to be compatible with the genetically modified immunoresponsive cells, or their progenitors.
[0322] [0322] The compositions can be isotonic, that is, they can have the same osmotic pressure as blood and lacrimal fluid. The desired isotonicity of the compositions can be accomplished using sodium chloride, or other pharmaceutically acceptable agents such as dextrose, boric acid, sodium tartrate, propylene glycol or other inorganic or organic solutes. Sodium chloride can be particularly for buffers containing sodium ions.
[0323] [0323] The viscosity of the compositions, if desired, can be maintained at the selected level using a pharmaceutically acceptable thickening agent. For example, methyl cellulose is easily and economically available and easy to work with. Other suitable thickening agents include, for example, xanthan gum, carboxymethyl cellulose, hydroxypropyl cellulose, carbomer and the like. The concentration of the thickener may depend on the agent selected. The important point is to use an amount that will reach the selected viscosity. Obviously, the choice of carriers and other suitable additives will depend on the wrong route of administration and the nature of the particular dosage form, for example, liquid dosage form (for example, whether the composition is to be formulated in a solution, a suspension, a gel or another liquid form, such as a programmed release form or liquid filled form).
[0324] [0324] The number of cells to be administered will vary for the subject being treated. In one embodiment, between about 10 ° and about 10 °, between about 10 ° and about 10 °, or between about 10 ° and about 108 of the currently described immunoresponsive cells are administered to a human subject. More efficient cells can be administered in even smaller numbers. In certain embodiments, at least about 1x10 °, about 2x108, about 3x108, about 4x108, or about 5x10 ° of the currently described immunoresponsive cells are administered to a human subject. In certain embodiments, between about 1x107 and 5x108 of the currently described immunoresponsive cells are administered to a human subject. The exact determination of what can be considered an efficient dose can be based on individual factors for each subject, including the size, age, sex, weight and condition of the particular subject. Dosages can be easily determined by those skilled in the art from this description and knowledge of the art.
[0325] [0325] Those skilled in the art can easily determine the amount of cells and additives, vehicles and / or optional carriers in compositions and be administered in the methods. Typically, any of the additives (in addition to the cell (s) and / or active agent (s)) are present in an amount of 0.001 to 50% (weight) of phosphate buffered saline solution, and the active ingredient is present in the order of micrograms to milligrams, such as about 0.0001 to about 5% by weight, about 0.0001 to about 1% by weight, about 0.0001 to about 0.05 % by weight or about 0.001 to about 20% by weight, about 0.01 to about 10% by weight, or about 0.05 to about 5% by weight. For any composition to be administered to an animal or human, the following can be determined: toxicity such as determining the lethal dose (LD) and LDSO in a suitable animal model, for example, rodent such as mouse; the dosage of the composition (s), concentration of components in it (s) and time of administration of the composition (s), which provoke an adequate response. Such determinations do not require undue experimentation, based on the knowledge of those skilled in the art, this description and the documents cited here. In addition, the time for sequential administrations can be determined without undue experimentation.
[0326] [0326] The subject in question currently described provides methods to induce and / or increase an immune response in a subject who needs them. The currently described immunoresponsive cells, and compositions comprising them, can be used to treat and / or prevent a neoplasm in a subject. The currently described immunoresponsive cells, and compositions comprising them, can be used to prolong the survival of a subject suffering from a neoplasm. The currently described immunoresponsive cells, and compositions comprising them, can also be used to treat and / or prevent a pathogen infection or other infectious disease in a subject, such as an immunocompromised human subject. In certain embodiments, immunoresponsive cells comprising a CAR described herein can be used to treat a subject with a relapse of a disease, in which the subject has received treatment leading to residual tumor cells. In certain embodiments, residual tumor cells show low density of a target molecule on the surface of tumor cells. In certain embodiments, a target molecule with a low density on the cell surface has below about 10,000 molecules per cell, below about 8,000 molecules per cell, below about 6,000 molecules per cell, below about 4,000 molecules per cell, below about 2,000 molecules per cell, below about 1,000 molecules per cell, below about 500 molecules per cell, below about 200 molecules per cell, or below about 100 molecules per cell, In certain embodiments, a target molecule with low density on the cell surface has between about
[0327] [0327] An "efficient amount" (or, "therapeutically efficient amount") is an amount effective to produce a beneficial or desired clinical outcome through treatment. An effective amount can be administered to a subject in one or more doses. In terms of treatment, an efficient amount is an amount that is sufficient to palliate, improve, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease. The effective amount is generally determined by the physician on a case-by-case basis, and known to those skilled in the art. Several factors are taken into account in a typical way when determining an appropriate dosage to achieve an efficient amount. These factors include the subject's age, sex and weight, the condition to be treated, the severity of the condition and the efficient form and concentration of the administered immunoresponsive cells.
[0328] [0328] For adoptive immunotherapy using antigen-specific T cells, doses of cells in the range of about 10º-10 * º (for example, about 10º) are typically infused. Upon administration of the cells currently described in the host and subsequent differentiation, the T cells that are induced are targeted - specifically - against the specific antigen. Immunoresponsive cells can be administered by any method known in the art including, but not limited to, intravenous, subcutaneous, intranodal, intratumoral, intrathecal, intrapleural, intraperitoneal and directly into the thymus.
[0329] [0329] The subject in question currently described provides methods for treating and / or preventing a neoplasm in a subject. The method may comprise administering an efficient amount of the currently described immunoresponsive cells, or a composition comprising them, to a subject with a neoplasm.
[0330] [0330] Non-limiting examples of neoplasia include cancers in the blood (for example leukemias, lymphomas, and myelomas), ovarian cancer, breast cancer, bladder cancer, brain cancer, colon cancer, intestinal cancer, liver cancer, cancer of lung, pancreatic cancer, prostate cancer, skin cancer, stomach cancer, glioblastoma, gargantay melanoma cancer, neuroblastoma, adenocarcinoma, glioma, soft tissue sarcoma and various carcinomas (including prostate cancer and small cell lung). Additional suitable carcinomas include any of those known in the field of oncology including, but not limited to, astrocytoma, fibrosarcoma, myxosarcoma, liposarcoma, oligodendroglioma, ependymoma, medulloblastoma, primitive neural ectodermal tumor (PNET), chondrosarcoma, ductogenic adenocarcinoma, adenocarcinoma, adenocarcinoma, adenocarcinoma, adenocarcinoma, adenocarcinoma small and large cell lung, chordoma, angiosarcoma, endotheliosarcoma, squamous cell carcinoma, bronchoalveolarcarcinoma, epithelial adenocarcinoma, and liver metastases thereof, lymphangiosarcoma, lymphangioendotheliosarcoma, hepatoma, cholangiocarcinoma, tumor, cancer colon, basal cell carcinoma, sweat gland carcinoma, papillary carcinoma, sebaceous gland carcinoma, papillary adenocarcinoma, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, kidney cell carcinoma, bile duct carcinoma, embryocarcinoma, carcinoma, semino io, Wilms' tumor, testicular tumor, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, - neuroblastoma, —retinoblastoma, leukemia, multiple myeloma, and macroglobulinemia such as ductal and lobular adenocarcinoma, squamous and uterine cervical adenocarcinomas, uterine and ovarian epithelial carcinomas, prostatic adenocarcinomas, transitional squamous cell carcinoma of the bladder, B and T cell lymphomas (nodular and diffuse), plasmacytoma, acute and chronic leukemias, malignancy, soft tissue sarcomas and leiomyosarcomas.
[0331] [0331] Subjects may have an advanced form of the disease, in which case the objective treatment may include mitigating or reversing the progression of the disease, and / or improving side effects. The subjects can present a history of the condition, for which they have already been treated, in which case the therapeutic objective will typically include a decrease or delay in the risk of recurrence.
[0332] [0332] Human subjects suitable for therapy typically comprise two treatment groups that can be distinguished by clinical criteria. Subjects with “advanced disease” or “high tumor burden” are those who carry a clinically measurable tumor. A clinically measurable tumor is one that can be detected on the basis of tumor mass (for example, by palpation, tomography, sonogram, mammography or X-ray; positive biochemical or histopathological markers alone are insufficient to identify its population). A pharmaceutical composition is administered to these subjects to elicit an anti-tumor response, in order to alleviate their condition. Ideally, the reduction in tumor mass occurs as a result, but any clinical improvement is a benefit. Clinical improvement includes risk or decreased rate of progression or reduction in the pathological consequences of the tumor.
[0333] [0333] A second group of suitable subjects is known in the art as the "adjuvant group". These are individuals who had a history of cancer, but were responsive to another mode of therapy. Previous therapy may have included, but is not restricted to, surgical resection, radiation therapy and traditional chemotherapy. As a result, these individuals did not present any clinically measurable tumor. However, they are suspected of being at risk for disease progression, both near the site of the original tumor and by metastasis. This group can be further subdivided into high risk and low risk individuals. The subdivision is performed on the basis of characteristics observed before or after the initial treatment. These characteristics are known in the clinical arts, and are properly defined for each different neoplasm. Typical characteristics of high-risk subgroups are those in which the tumor has invaded neighboring tissues, or which show lymph node involvement.
[0334] [0334] Another group has a genetic predisposition to neoplasia, but has not yet shown clinical signs of neoplasia. For example, women who test positive for a genetic mutation associated with breast cancer, but still of childbearing age, may wish to receive one or more of the immunoresponsive cells described here under prophylactic treatment to prevent the occurrence of cancer until preventive surgery is appropriate. .
[0335] [0335] Additionally, the subject matter currently described provides methods for treating and / or preventing a pathogen infection (eg, viral infection, bacterial infection, fungal infection, parasite infection, or protozoa infection) in a subject, for example example, in an immunocompromised subject. The method may comprise administering an efficient amount of the currently described immunoresponsive cells, or a composition comprising them, to a subject with a pathogen infection. Exemplary viral infections susceptible to treatment include, but are not limited to, infections by Cytomegalovirus (CMV), Epstein Barr virus (EBV), human immunodeficiency virus (HIV) and influenza virus.
[0336] [0336] Additional modification can be introduced to the currently described immunoresponsive cells (for example, T cells) to avoid or minimize the risk of immunological complications (known as “malignant T cell transformation”), for example, host-versus-disease graft (GvHD), or when healthy tissues express the same target antigens as tumor cells, leading to results similar to GvHD. A potential solution to this problem is to genetically modify a suicide gene in the currently described immune-responsive cells. Suitable suicide genes include, but are not limited to, Herpes simplex virus thymidine kinase (hsv-tk), inducible suicidal Caspase 9 gene (iCasp-9) and a truncated human epidermal growth factor receptor (EGFRt) polypeptide. In certain embodiments, the suicide gene is an EGFRt polypeptide. The EGFRt polypeptide can enable T cell elimination by administering anti-EGFR monoclonal antibody (for example, cetuximab). EGFRt can be covalently joined upstream from a currently described CAR. The suicide gene can be included in the vector comprising nucleic acids that encode a currently described CAR. In this way, the administration of a prodrug designed to activate the suicide gene (for example, a prodrug (for example, AP1903 that can activate iCasp-9) during the transformation of malignant T cells (for example, GVHD) activates apoptosis in T cells expressing a suicide gene-activated CAR The incorporation of a suicide gene into a currently described CAR provides an additional level of security, with the ability to eliminate most CAR T cells in a very short period of time. A currently described immunoresponsive cell (for example, a T cell) incorporated with a suicide gene can be preventively eliminated, at a certain point in time, after the infusion of the T cell CAR, or eradicated at the first symptoms of toxicity.
[0337] [0337] The subject in question currently described provides kits to induce and / or improve an immune response, and / or treat, and / or prevent a neoplasm or a pathogen infection in a subject. In certain embodiments, the Kit comprises an efficient amount of currently described immunoresponsive cells or a pharmaceutical composition comprising them. In certain embodiments, the Kit comprises a sterile container; such containers can be boxes, ampoules, bottles, flasks, tubes, bags, bags, blister packs, or other forms of suitable containers known in the art. Such containers may consist of plastic, glass, laminated paper, metal foil, or other materials suitable for retaining medications. In certain non-limiting modalities, the Kit includes an isolated nucleic acid molecule that encodes a CAR currently described, which is directed to an antigen of interest in expressible form, which can optionally be comprised in one or more vectors.
[0338] [0338] If desired, immunoresponsive cells and / or nucleic acid molecules are provided together with instructions to administer the cells or nucleic acid molecules to a subject with, or at risk of developing, a neoplasm, or pathogen or immune disorder. The instructions generally include information related to the use of the composition for the treatment and / or prevention of a neoplasm, or a pathogen infection. In certain embodiments, the instructions include at least one of the following: description of the therapeutic agent; dosage and administration schedule for treatment or prevention of a neoplasm, infection by pathogen, or immune disorder, or symptoms thereof; precautions; care; indications; contraindications; overdosage information; Adverse reactions; animal pharmacology; clinical studies and / or references. Instructions can be printed directly on the container (when present), or as a mark applied to the container, or as a separate sheet, pamphlet, card, or leaflet provided on or with the container. EXAMPLES
[0339] [0339] The practice of the present description employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the reach of those skilled in the art. Such techniques are fully explained in the literature such as, “Molecular Cloning: A Laboratory Manual”, second edition (Sambrook, 1989); “Oligonucleotide Synthesis” (Gait, 1984); "Animal Cell Culture" (Freshney, 1987); "Methods in Enzymology" "Handbook of Experimental Immunology" (Weir, 1996); "Gene Transfer Vectors for Mammalian Cells" (Miller and Calos, 1987); “Current Protocols in Molecular Biology" (Ausubel, 1987); “PCR: The Polymerase
[0340] [0340] The following examples are presented in order to provide those skilled in the art with full disclosure and description of how to prepare and use the cells and compositions currently described, and are not intended to limit the scope of which the inventors consider their invention .
[0341] [0341] Multiple ITAMs in the CD36 and TCR complex have been proposed to amplify TOR signals (PMID: 20516133). However, CD28 provides quantitative support for TOR signaling (PMID: 14647476). Therefore, the number and type of signaling domains matter in TCR signaling. In human T cells, CD28 and TCR / CD37 are expressed in -6 x 10º and -2 x 10º molecules per cell (PMID: 14647476). Therefore, three CD28 molecules can provide signaling support for a TCR / CD37 molecule, which has three ITAMs. However, the second generation CAR 1928z presents the design of fused cytosolic domains CD28 and CD37, fixing their stoichiometry ratio to be one. With superior extermination and proliferation capabilities, CAR 1928z allows rapid elimination of cells that carry CD19 in vitro, in mouse models and in patients. However, the current CAR 1928z improvement is needed to overcome some issues in clinical trials. One issue is the cytokine release syndrome (CRS), characterized by massive synchronized T cell activation and the release of large amounts of cytokines. Although the CRS mechanism is still undefined, it may be related to excessive signaling of CAR 1928z T cells. Another issue is the exhaustion and persistence of CAR T cells. It is observed that CAR 19287 T cells exist in small numbers, and / or in a dysfunctional state that expresses exhaustion markers, such as PD-1, weeks or months after infusion, which may explain some cases of relapse. It is hypothesized that exhaustion is linked to excessive activation (PMID: 26331345), which can be attributed to the intrinsic properties due to the CAR 1928z design.
[0342] [0342] Comparing the 1928z CAR signaling with the TCR signaling, some major differences due to the fusion of two cytosolic domains are obvious. First, in the CAR, the CD28 signaling domain is in cis with the CD37 signaling domain, while CD28 is recruited at the synapse and co-located with CD37 in trans. Second, CD28 activation is concurrent with CD37 activation in CAR, while CD28 costimulation is seconds after TCR binding. Third, three CD28 molecules assist a TCR, although the reason is one to one in CAR. The first two differences are not easy to modify in the current CAR design, but the third difference can be addressed by balancing the co-stimulation signal and the activation signal, which can help to solve the existing problem of over-stimulation. The CD28 / CD376 ratio cannot be changed directly due to the fusion design, but the number of ITAMs in CD36 can be mutated to mimic the TCR signaling ratio. The three ITAMs in CD3Z differ in their main amino acid sequence, as well as their positions with respect to the plasma membrane (ie, ITAM1, ITAM2, ITAM3 from the proximal to the distal membrane) and, therefore, the ability to be phosphorylated by Lck or if binding to ZAP70 by phosphorylation are different (PMID: 23555234). A previous study of ErbB2 CAR based on CD28 with only one ITAM in the second position showed reduced apoptosis in vitro (PMID: 19843940), but further characterization of CAR and in vivo studies are still missing. Therefore, unprecedented CARS based on the CAR 1928z project were designed, which introduced defined numbers and ITAM positions, in order to assess their functionality, especially in terms of the issues mentioned above, including their impact on persistence, differentiation, exhaustion and anti-tumor activity. of a T cell. It was analyzed how each ITAM coupled to CD28 signaling in the context of CAR 1928z affects the complete function of CAR in vitro and in vivo. ITAM1 coupled to CD28 was not only better than ITAM2 or ITAM3 coupled to CD28, but better more importantly than the original CAR 1928z in terms of antitumor efficiency in vivo, making it a great candidate for clinical applications. All studies were performed on human peripheral blood T cells. RESULTS
[0343] [0343] - CD37 ITAM domains in 19287 CARs exert qualitatively differential T cell function.
[0344] [0344] The first step was to explore whether each CD36 ITAM in the 2nd generation 19282z-CAR construction contributes qualitatively different functions, or whether individual ITAMs exhibit overlap and functional redundant properties. In order to assess the contribution of each individual ITAM to the CAR 1928z function, CARs 1928z with only a single functional ITAM domain were generated (1XX, X2X and XX3, see Figure 1A). The signaling of the two remaining ITAMs was interrupted by insertion of point mutations that convert the two tyrosines (Y) into phenylalanines (F), thus disabling phosphorylation and consecutive recruitment of ZAP70 for complete activation of upstream signaling pathways. T cells were efficiently transduced using SFG retroviral vectors with comparable transduction rates between different constructs (Figure 16).
[0345] [0345] In order to compare the therapeutic potential of the generated 19282z mutants, a sub-ideal dose of 5 x 10 X T cells * CAR T cell * was administered in a NALM-6 mouse model with pre-B acute lymphoblastic leukemia previously described, and compared to the efficiency of the treatment of mice with 1928z wild type (19282 WT) (Figure 2).
[0346] [0346] A gradual difference in tumor eradication and mouse survival in relation to the relevant functional ITAM was observed: ITAM1 (1XX) or unmodified ITAM2 (X2X), in its original CAR 1928z position, showed better antitumor activity compared to the 3 ITAMs functional, as in the original 1928z wild type (WT). In contrast, ITAM3 as the only functional ITAM, in combination with dysfunctional ITAMs 1 and 2 (XX3) performed poorly, with reduced tumor eradication and reduced mice survival (Figure 3).
[0347] [0347] Therefore, individual ITAMs in 19287 CARs exercised qualitatively different functions during the maintenance of the original position in the 2nd generation 1928z structure. The efficiency of tumor eradication gradually decreased with each additional distal position of the functional ITAM: 1XX consistently showed rapid tumor eradication and achieved long-term complete remissions, whereas treatment with X2X delayed tumor progression and was greater than 192827 WT , but eventually relapses occurred. XX3 with its non-mutated (natural) ITAM in the most distal position did not reach tumor control, leading to rapid tumor progression and reduced survival rates (Figure 3). In conclusion, 1928z CARs with 1 or 2 ITAMs in the second or third ITAM position (XX3, X2X, X23) were less active or not more therapeutically active (in vivo) than 1928z wild type.
[0348] [0348] A single functional CD36 ITAM in the correct position is sufficient for potent anti-tumor activity.
[0349] [0349] The next question addressed was whether the combination of the two functional ITAMs in the distal position - ITAM2 and ITAM3 (X23, Figure 1A) - which should have less affinity with ZAP7O0 than ITAM1— can improve the efficiency of their mutant ITAM 19287 together relevant single (X2X / XX3). In vivo analyzes revealed gloomy tumor clearance and survival of mice treated with X23, comparable to the result of mice treated with XX3 (Figures 2 and 3). In contrast, 1928z mutant CARs with only a single functional ITAM, both in the first (1XX) and in the second (X2X) position, emerged to be superior to the 1928z CARs with two (X23) or three (WT) functional ITAMs, as reflected in the course of tumor burden and survival. 1XX consistently proved to be the most potent 1928z mutant, achieving rapid and durable tumor eradication, even at a very low treatment dose. The results thus indicate that a single ITAM is sufficient to efficiently exterminate, but they also reveal significant differences in the therapeutic efficacy of dependent T CAR cells, in which ITAM in the
[0350] [0350] Next, it was analyzed whether the reduced function of CAR in XX3 was attributed to the individual specificity of ITAM3, or related to the more distal position of ITAM3 in the context of a 2nd generation CAR, compared to its natural position. 19287 mutant CARs with ITAM1 or ITAM3 in exactly the same proximal position as CAR (D12 and D23,) and elimination of the remaining CD36 chain, enabling direct comparison of the two ITAMs in the 1928-CAR context (Figure 1), were therefore generated. The results showed that ITAM3 in a more proximal position (D12) was sufficient for rapid and efficient long-term tumor clearance (Figures 2 and 3), showing results comparable to D23. Despite sharing the same ITAM (ITAM3), D12 clearly surpassed XX3 and achieved efficient antitumor potency. The significant difference in therapeutic efficacy between D12 and XX3 thus demonstrates the impact of the ITAM position on the 2nd generation CAR. In conclusion, 1928z CARs with a single ITAM (both ITAM1 in 1XX and D23 and ITAM 3 in D12) in the first ITAM position were more therapeutically active (in vivo) than 1928z wild type.
[0351] [0351] Although D23 and 1XX have ITAM1 as the only functional ITAM in common, 1XX showed improved functional properties compared to D23, resulting in greater T cell proliferation and favorable T cell phenotype (Figures 4 and 5). This maintains that the rich basic extension (BRS) in the CD37 chain - which has previously been shown to mediate membrane association and modulate signaling - can be attributed to the functional properties of CAR 1928z (Figure 1B).
[0352] [0352] Additional mutations in the 1XX CAR structure were therefore inserted, thus interrupting the signaling of BRS-2 and -3 (= 1XX BRSnegative). This demonstrated that the BRS regions were essential for the 1XX function, since 1XX BRSnegative showed reduced proliferative and extermination function in vitro and in vivo. Therefore, the functional importance of the BRS regions was demonstrated in 1XX.
[0353] [0353] CD37 ITAM mutations allow for better T cell proliferation in 19287 CARs and limit T cell differentiation and exhaustion.
[0354] [0354] In vivo studies revealed increased CAR T cell accumulation for all CAR groups with a functional ITAM and two mutated ITAM regions: cell numbers of XX3, X2X and 1XX achieved significantly higher T cell accumulation at tumor sites, compared at 1928z WT after 17 days (Figure 4). T cells expressing 1928z mutant CARs containing a single ITAM (XX3, X2X, 1XX) accumulated in vivo at a higher level than T cells expressing the wild type 28z CAR. CARs containing 2 or more ITAMs (192872 and X23) showed decreased accumulation in relation to T cells that express a single ITAM CAR (XX3, X2X, 1XX, D23 and D12).
[0355] [0355] Higher T cell accumulation was associated with lower T cell differentiation, as reflected in the percentage of central memory cells (CD62L + CD45RA-) (Tcm) and effector cells (CD62L-CD45RA +) (TerFF) in T cells CAR CD4 * and CD8 *: 1IXX showed a significantly higher percentage of Tcw - a T cell phenotype that is associated with better proliferation potential in vivo - and significantly lower percentage of terminally differentiated Trerr compared to the 1928z WT (Figure 5). On the other hand, 1XX showed significantly higher numbers of Tcvw cells and T cells that express the memory-associated IL7R marker in the bone marrow of treated mice, on the 17th day after the CAR infusion. In addition, both T cell populations showed a significant increase from day 10 to day 17 after CAR administration (Figure 6). Overall, 1XX caused the largest fraction of memory T cells, and D23 was the second best in the long-term in vitro assay. Delayed differentiation and an increase in T CAR cells expressing IL7R have also been observed in vitro, through repeated exposure to the antigen (data not shown).
[0356] [0356] In addition, the 1928z mutants differed in the degree of T cell exhaustion, as determined by the coexpression of PD1, TIM3 and LAG3 inhibitory molecules that are associated with less antitumor activity. Groups of 19287 mutants with a single functional ITAM and elimination of the two other ITAMs (D12 and D23) showed significantly less expression of exhaustion markers (Figure 7).
[0357] [0357] XX3 exceeded 1928z WT in CAR numbers at the tumor site (Figure 4) and showed a high percentage of Tcm, but these cells were not able to prevent tumor progression. The mice treated with XX3 demonstrated an initial treatment response, but relapsed after a short time. Functional in vitro analyzes demonstrated reduced extermination activity, as well as decreased secretion of Th1 cytokine and granzyme B (GrB) in XX3 (Figures 8 and 9). Figure 8 shows that in standard in vitro cytotoxicity assays, all CARs lyse tumor cells similarly, with the exception of XX3 which performs decreased cytolytic activity. Although all constructs show similar and potent cytotoxic activity after the initial T cell transduction, differences emerged after CAR expansion through repetitive exposure of Ag (Figure 8). Figure 9 shows that the standard in vitro cytokine assays do not correlate with functional characteristics in vivo, but 1XX and D23 show favorable profiles (IL2 and antitumor cytokines, such as IFNg and TNFa).
[0358] [0358] These findings indicate no coupling of effector function and proliferation in XX3, and show that the expansion and persistence of T CAR cells were not sufficient for efficient tumor eradication. In contrast, 1928z WT exerted high cytotoxic activity, but acquired early differentiation in effector cells and increased positive regulation of inhibitory molecules, leading to reduced exhaustion and persistence of 1928z CARs. CONCLUSION
[0359] [0359] Functional redundancy and increased signaling, due to the combined activation of CD37 and co-stimulation of CD28 in 2nd generation 1928z CARs, can lead to early T cell differentiation and exhaustion, thus decreasing antitumor activity. The contribution of simple ITAMs to the CAR function, therefore, was analyzed. Position, affinity and number of ITAMs in the CD37 chain differentially affected the functional properties of CAR 19282z T cells. In general, 1928z CARs containing a single ITAM direct the accumulation of upper T cell, memory formation and decreased exhaustion (Figures 4-7), but the single ITAM must be positioned in the first position to provide the greatest therapeutic activity (antitumor) ( Figures 2-3). 1XX understood the most favorable properties of both effector cells and memory, thus balancing activation and differentiation. 1XX regulates the strong activation of CD36 signaling and combined CD28 stimulation, and intensities with fine adjustments in appropriate intracellular signals, thus modulating the CAR-mediated signaling, which then results in the superior long-term tumor eradication.
[0360] [0360] Alternative hinge / spacer regions and transmembrane domains have been tested in CAR constructions. The schematic representation of 1XX CARs that carry different hinge (H) and transmembrane (TM) domains is shown in Figure 10. All tested hinge and transmembrane domains belong to the immunoglobulin superfamily (I9SF) and are capable of forming cell surface homodimers. . All constructs were cloned in a bicistronic P2A oncorretroviral vector (SFG) that encodes the CAR and LNGFR. The flow cytometry profiles show the expression of CAR and LNGFR using IgG (F (ab ') 2) fragment of goat anti-mouse and anti-LNGFR IgG, respectively. T cells were obtained from PBMC (peripheral blood mononuclear cells) from healthy donors, transduced stably 48 hours after activation, and analyzed for CAR expression over multiple periods of time. The CAR 19282z-LNGFR containing CD28 / CD28 H / TM regions was used as a control.
[0361] [0361] Replacing the CD28 / CD28 (H / TM) with the ICOS / ICOS (H / TM), CTLA-4 / CTLA-4 (H / TM) or ICAM-1 / ICAM-1 (H / TM) hinges the expression of CAR on the cell surface. CAR expression, however, was restored when the CD28 hinge was fused to the transmembrane ICOS (CD28 / ICOS; H / TM). However, CAR expression was not rescued in the CD28 / CTLA-4 (H / TM) configuration. These findings indicate the non-obviousness of H / TM combinations found that enable efficient expression of CAR. In conclusion, 1XX CARs that have both CD84 / CD84, CD166 / CD166, CD8a / CD8a, CD8b / CD8b and CD28 / ICOS (H / TM) regions were expressed similarly on the T cell surface, of which 3 are unable to dimerize with CD28: CD166-28z, CD8a-287z, CD8b-287z.
[0362] [0362] Cumulative T CAR cell counts after weekly stimulation starting from 106 cells / ml T CAR cells are shown in figure 11. The proliferation of T CAR cells induced by weekly CD19 exposure was first evaluated in vitro by 21 days. CAR T cells were co-cultured with CD19 * NIH 3T3s irradiated without any exogenous cytokine. Each week, 10th cells / ml of CAR * T cell were added to the irradiated and new CD19 * NIH 3T3s. The CAR 1928z-1XX-LNGFR with CD28 / CD28 (H / TM) was used as a reference. The in vitro proliferation of 19-CD166-28z was similar to the wild type 1928z.
[0363] [0363] The data was organized based on the detection of T cell surface CAR. CAR-transduced T cells carrying ICOS / ICOS (H / TM), CTLA-4 / CTLA4 (HTM), ICAM-1 / ICAM-1 (or CD28 / CTLA-4 (H: TM) were unable to accumulate after co-cultivation with CD19 + NIH 3T3 cells T CAR cells with CD84 / CD84 and CD8b / CD8b (H / TM) were able to accumulate after the 2 stimulation cycle, however, these cells lose their accumulation capacity after the third cycle The T CAR cells with CD166 (HTM), CD8a (H / TM) and CD28 / ICOS (H / TM) do accumulate as efficiently as the CAR 1928Z-1XX control T cells.
[0364] [0364] The cytotoxic activity of CAR T cells was assessed using a 4-hour 5'Cr release assay at the end of the third stimulus (D21), the results of which are shown in figure 12. T-cells and EL-4 target cells -CD19 + were used in different Effective ratio: Target (E: T). EL-4-PSMA cells were used as a control. The in vitro cytotoxic potential of all well expressed variations of H / TM CD28 / CD3z was similar, as expected. The cytotoxic capacity of T cells with CD166 (HTM), CD8a (HTM) and CD28 / ICOS (H / TM) domains was comparable to T28 cells with CD28 / CD28 (H / TM).
[0365] [0365] The in vivo antitumor efficacy of different CAR H / TM T cells using NOD.Cg Prkdescidll2rgtm 1Wil / SzJ mice (immunodeficient NSG) is shown in figure 13. The mice were injected into the caudal vein with 5 x 10 FFLuc-GFP cells NALMG6 (pre-B ALL cell line), followed by 2x10º T CAR cells after four days. The tumor load was followed by weekly quantification of the bioluminescent signal. All constructs selected for in vivo study, CD166 / CD166 (HTM), CD8a / CD8a (H / TM) and CD28 / ICOS (H / TM), were able to completely eradicate tumor cells. No significant difference in tumor load or survival was observed for any condition compared to the control group, the CAR 1928z T cells. EXAMPLE 3 - DEIMUNIZATION STRATEGY
[0366] [0366] The juxtaposition of human sequences or their mutation carries the risk of creating new antigens. The unprecedented CD166 junctions and 1XX mutations were thus de-immunized. The immunogenicity of junctions between different CAR fractions was predicted using the NetMHC 4.0 server. A total of 26 amino acids (13 amino acids from the first fraction and 13 amino acids from the second fraction) were selected. For each peptide generated (14, 13, 12, 11, 10, 9 and 8 mers) containing at least 1 aa of the following fraction, binding affinity with HLA A, B and C was predicted for all alleles. An immunogenicity score for each peptide was assigned to each peptide. The immunogenicity score was calculated using the formula Immunogenicity score = | [(50-binding affinity) * HLA frequency] n. 50 nm was used as a cut for strong binding affinity. The frequency of HLA in the Caucasian population was used. n = prediction number for each peptide. The frequency of HLA below 1% of the total population was excluded. For de-immunization of joints, the mixture of both amino acids that form the junction or elimination of amino acids, from both sides of the junction, was tested. The previously described immunogenicity prediction strategy was used for each newly generated peptide. The junction with minimum immunogenicity score was used to construct a de-immunized CAR. Exemplary de-immunization strategies are shown in figure 14.
[0367] [0367] Foster immunotherapy using chimeric antigenic receptors (CARs) has shown remarkable clinical results in the treatment of leukemia and lymphoma, and is a promising immunotherapy applicable in principle to a wide range of cancers. Two promising CAR projects have been successfully introduced into the clinic, one using the cytoplasmic domain of CD28 as the co-stimulatory component and the other using the cytoplasmic domain of 4-1BB. In both examples, T cell activation is initiated through the fused cytoplasmic domain of the CD3 zeta chain. While both projects have achieved remarkable results, clinical results are limited by deficiencies in these CAR structures. T cells expressing CARs based on CD28 are potent, but of short duration, while T cells expressing CARs based on 4-1BB have a longer life, but allow escape of antigen from tumor cells that express low levels of the antigen target. Thus, there is a need for unprecedented CAR projects that prolong the persistence of T cells without compromising function. RESULTS
[0368] [0368] The currently described CD28z CAR T cells can recover relapses of ALL with little CD19 after treatment with CAR 4-1BBz T cells. This can be a major recovery route for the many relapses that occur after treatment with CAR 4-1BBz T cells, excluding those that are stably negative for CD19.
[0369] [0369] - NSG mice were injected into the caudal vein with 5 x 105 FFLuc-GFP NALMG6 cells (pre-B ALL cell line), followed by 2x10º T cells 19BBz after four days. Ten days after the 1st T cell injection (an ineffective dose that only slows the progression of the tumor), the mice were again injected with CAR 19BBz T cells, or alternatively with each 19282z or (5 x
[0370] [0370] In conclusion, CD28z CAR T cells can recover from 4-1BBz CAR T cell failures. In view of the previous examples, the modified CD28z T CAR cells described here, such as CAR 1XX, D23 and D12 T cells (with multiple hinge / TM domains, such as CD166 hinge / TM domains), may be even more efficient than the CAR 1928z T cells in recovering CAR 4- 1BBz T cell failures.
[0371] [0371] This example is an updated and additional investigation of certain aspects of example 1.
[0372] [0372] Chimeric antigenic receptors (CARs) are synthetic receptors that target and reprogram T cells to acquire increased antitumor properties ”. Specific CD19 CARs that comprise CD28 and CD37 signaling motifs induced remarkable responses in patients with refractory leukemia and linforms, and have recently been approved by the US Food and Drug Administration. ” These CARs program high-performance effector functions that mediate the potent elimination of the tumor * 8, despite the limited persistence they confer on T2-68 cells, Extending their functional persistence without compromising their effectiveness can improve current CAR therapies. Does strong T cell activation lead to exhaustion º, which can be accentuated by the redundancy of CD28 and CD3Ç !! - 12 Signaling, as well as the space-time restrictions transmitted by the structure of second generation CARs . Thus, it is hypothesized that calibrating the activation potential of CD28-based CARs would differentially reprogram T cell function and differentiation. Here, CARs that encode a single activation motive based on tyrosine immunoreceptor direct T cells to different destinations, balancing effector and memory programs, thereby yielding CAR projects with better therapeutic profiles.
[0373] [0373] It is hypothesized that the redundancy of CD28 and CD3 signaling in a chimeric antigenic receptor (CAR) project, which incorporates all three reasons for CD3 tyrosine-based immunoreceptor activation (ITAMs) 13, can promote differentiation and harmful T cell exhaustion * º. Therefore, the activity of ITAM was calibrated by mutating tyrosine residues to prevent its phosphorylation and signaling downstream 4-7, To investigate the contribution of each of the three CD3 ITAMs regarding the function, differentiation and therapeutic efficacy of T cells genetically modified with 1928z, 1928z mutants containing a single ITAM, named 1XX, X2X, and XX3, were generated (figure 16A). In an additional mutant, called X23, the two distal ITAMs (ITAM2 and ITAM3) were maintained, both of which were shown to exhibit lower binding affinity with protein tyrosine kinase ZAP-70 compared to ITAM113: 18, All mutant CARs were expressed similarly in peripheral blood T cells, retroviral transduced, (figure 16B); were observed for targeting indistinguishable cytotoxicity in a 4-hour chromium-51 (6 Cr) release assay and proliferation in response to three weekly stimuli with CD19 antigen (figures 20A-20B).
[0374] [0374] Notably, did the therapeutic efficiency of CAR T cells expressing these mutant CARs differ singularly in the Nalm6 mouse model with well-established pre-B lymphoblastic leukemia 19.20, CAR T T cell doses were deliberately reduced to better compare the effectiveness of T cells, as previously described in CARºÉ stress tests. With respect to the parental 1928, XX3 showed markedly decreased antitumor efficiency, achieving only a transient reduction in tumor burden, while 1XX exceeded 19282, inducing long-term remission in all mice (figure 16C and figure 20C). Treatment with X2X and X23 did not significantly change survival rates compared to 1928 (1928 versus X2X: P = 0.6942; 1928 versus X23: P = 0.1085).
[0375] [0375] Thus, although the presence of one (1XX, X2X, XX3), two (X23), or three (1928z) functional ITAMs did not visibly alter the in vitro function in the short term, a CAR containing a single ITAM outperformed the CARs containing triple and double ITAM in vivo. The tumor eradication efficiency gradually decreased with the increase in the distal positioning of the functional ITAM. The 1XX CAR consistently showed rapid tumor eradication and was the only CAR design to achieve complete and durable remissions at the lowest dose of T cell. X2X treatment somewhat delayed tumor progression compared to the wild type 1928z, but eventually developed relapses . The XX3 CAR did not reach any control tumor, leading to rapid tumor progression and significantly reduced survival (figure 16C and figure 20C).
[0376] [0376] To investigate the functional basis for these major differences in antitumor efficiency, the responses transmitted by these CARs were examined in greater depth. In prolonged cytotoxicity assays (18 hours), at a lower effector-to-target ratio, XX3 proved to be less active than 1928z and the other mutants (figure 21A). The decreased effector function of XX3 was further corroborated by the reduced expression of granzyme B (GrB) (figure 21B), and lower secretion of type 1 (TH1) auxiliary T cell cytokine (TH1) polyfunctional and unique (figure 21C), after stimulation with targets of CD19 *. The inclusion of a single ITAM (both ITAM1, 2 and 3) limited T cell differentiation determined by CD62L / CD45RA expression, resulting in a greater fraction of central memory CAR T cells, and a reduced proportion of effector cells in response to the in vitro repetition stimulus with CD19 * targets (figure 20D).
[0377] [0377] These findings were extended in vivo, since T CAR cells with two inactive CD3 ITAM domains exhibited greater persistence (figure 16D) and delayed T cell differentiation (figure 16E). CAR 1XX, X2X, and XX3 T cells all showed a higher percentage of central memory T cells rrcm) CD62L * CD45RA, and a decrease in the fraction of effector cells (TEFF) CD62L-CD45RA * terminally differentiated (figure 16E and figure 20E ). The attenuation of effector differentiation in T CD4 * and CD8 * T cells was associated with greater accumulation of both T cell subsets at tumor sites (figure 16D), establishing the benefit of reducing CD3 signaling in second-generation CARs CD28 base.
[0378] [0378] It was then investigated whether the lower effectiveness of XX3 is intrinsic to ITAM3 or because of its distal position. Therefore, 19286 mutant CARs with both ITAM1 and ITAM3 in the same proximal CAR position, by eliminating the remaining CD3% Z chain, were generated (D12 and D23, figures 17A-17B). In vitro studies demonstrated equipotent cytolytic activity between all constructs in 4 and 18 hour assays, intact secretion of cytokine and GrB, and comparable proliferative potential between D12, D23 and 192867 (figures 21 and 22). However, D12 and D23 both surpassed 19287 in vivo, reaching complete eradication of the tumor (figure 17C and figure 22D). Both constructions of CAR moderately decreased T cell differentiation, and promoted greater accumulation of T cell CAR at the tumor site, compared to 19287 (figures 17D-17E). These findings show the importance of ITAM dosage and position in CARs 19287. A single functional ITAM is sufficient for potent anti-tumor efficiency, and superior to that provided by the wild type CD36 chain containing triple ITAM. In addition, the therapeutic efficacy transmitted by ITAM3 is less than that of ITAM1 in its respective natural positions (XX3 versus 1XX), but comparable in the same proximal position (D12 versus D23). Despite sharing the same ITAM sequence, D12 achieved superior tumor eradication compared to XX3, demonstrating the importance of the ITAM location in second generation CARs.
[0379] [0379] To rule out potentially confusing effects that originate from subtly different CAR expression levels, complementary CAR DNAs (DNAcs) have been targeted at the TRAC'º locus, thereby normalizing the regulation of the transgene and number of copy, while simultaneously removing the endogenous T cell receptor (TCR; figure 24A). Under these conditions, CAR 1XX T cells again outperform those that express 1928z or XX3 (figure 3a). TRAC-1XX T cells achieved complete remissions in 21 days, while TRAC-XX3 T cells only slowed the progression of the tumor, and were unable to achieve tumor control (figure 18A). Analyzes of CAR T cells and tumor cells recovered 17 days after CAR infusion showed greater accumulation of CAR T cells TRAC-1XX and TRAC-XX3, compared to TRAC-1928z, both in the CD4 * and CD8 * subsets (figure 18C and figures 24B and 24E). Greater persistence of T CAR cell was associated with a higher percentage of tcm and T cell counts of interleukin 7 receptor (IL7R) * (Figures 24C and 24D), reinforcing the delayed findings in T cell differentiation in 19280 mutants . Similar to retrovirus genetically modified T cells, TRAC-XX3 T cells have lost their cytolytic potential over time, unlike TRAC-1928z and TRAC-1XX cells (figure 24F). The expression of exhaustion markers was reduced in 1928z mutants, compared to TRAC-1928z, and the functional exhaustion of TRAC-1928z was confirmed by reduced TH1 cytokine secretion and expression of GrB / CD107a after CAR isolation from treated mice and exposed again ex vivo to Nalm6 cells (figure 18D and figure 25). While TRAC-1XX maintained high cytolytic function and the ability to co-produce multiple cytokines, TRAC-1928z exhibited a progressive inability to secrete TH1 cytokines associated with increased expression of exhaustion markers.
[0380] [0380] Follow-up studies in the near term, after the administration of two different doses of T cell (5 x 10º and 1 x 10º T cells CAR *), demonstrated unequivocally the therapeutic superiority of TRAC-1XX. While tumor-related deaths occurred in less than 60 days (treatment with 5 x 10 th T cell * cells) or less than 40 days (treatment with 1 x 10 th T cell cells *), all mice treated with TRAC-1XX showed complete tumor eradication and better survival throughout the observation period (figure 18B and figure 29).
[0381] [0381] The improved ability of 1XX to develop in highly functional long-term memory cells was further demonstrated when classified naive T cells were used for in vivo therapy. TRAC-1XX showed an increase in the population of cells expressing tcm and IL7R over time (figures 26A-26C), associated with improved persistence of very potent CAR T cells. Importantly, TRAC-1XX CARs were able to elicit efficient memory responses, achieving complete tumor control after new exposure to the tumor (figure 18E). Persistent CAR 1XX T cells comprised larger numbers of TCM, TEFF, and IL7R * CARs (figures 18F and 18G and figures 26D-26F). In contrast, TRAC-1928z acquired an exhausted phenotype more quickly (figure 3h, and extended data figure 79) accompanied by reduced persistence of the CAR T cell, with no memory formation and the inability to control new exposure to the tumor.
[0382] [0382] To further characterize these different phenotypes and functional patterns, the transcriptional profiles of the entire 19282z, 1XX, and XX3 genome were compared after stimulation with naive T cells CD19 antigen edited with TRAC. Principal component analyzes showed a distinct cluster of T CAR cells dependent on their CD3z mutation (figure 27A). Consistent with functional studies, the main differences emerged in the transcritomic profiles related to T cell function, differentiation and exhaustion. Analyzes of gene set enrichment (GSEA) revealed decreasing regulation of genes associated with naive / memory and enrichment of T cell activation. - and related effector genes in 19282z, with respect to both XX3 and 1XX (figure 19A and figure 27B). As expected, CAR 1928z T cells showed the best increasing regulation of T cell differentiation, exhaustion, and apoptosis gene expression profiles (figures 19B and 19C and figure 28A). Genetic ontology and GSEA analyzes identified significant increasing regulation of gene sets associated with inflammation, cytokine and chemokine activity in 1928z compared to XX3, and in 1XX compared to XX3 (figures 19C and figures 28B and 28C). These gene sets were also enriched in 1928z with respect to 1XX, although to a lesser extent, consistent with the intermediate state of 1XX with respect to 1928z and XX3 (figures 19B and 19C and figures 28B and 28C). To compare CAR T cells edited with TRAC in relation to effector and memory characteristics of the genetically unmodified CD8 * T cell subsets (Tn), stem cell memory (Tscm two or more), and TerF were classified from peripheral blood mononuclear cells at rest, since their characteristic transcriptional profiles were previously determined ! (figure 27C). The differentially expressed genes (adjusted P <0.05) were associated with the destination of the effector versus naive T cell, distinguished in these CAR constructions (figure 19B). Interestingly, TRAC-1XX cells exhibited more similarity with TSCM than with TTRAC-1928z and TRAC-XX3 cells, which in turn were more similar to TerrF and Tn cells, respectively (figure 19B).
[0383] [0383] Increasing regulation of key regulators of effector differentiation, such as T-bet (and T-bet: Eomes ratio), protein 1 from the PR zinc finger domain (PRDM1), and protein inhibitor ID-2 that binds to DNA (refs. 22—24) with simultaneous loss of markers / memory associated markers (eg CCR7, CD27, and IL7R2!) Corroborated the rapid acquisition of an effector state observed with 1928z (figures 19B and figures 28C and 28D) . In contrast, the signaling strength tuned to 1XX resulted in slowed T cell differentiation and conserved expression of important memory-associated transcription factors, such as transcription factor 7 (TCF7), B cell lymphoma protein 6 (BCL6), factor 1 binding to the lymphoid enhancer (LEF1), and factor 2 of the Krúppel type (KLF2) 23-% 6 (figure 19B), further reflected in the increasing regulation of genes regulated by KLF2, such as CCR7, CD62L, ITGB7 and SIPR1 ( refs.27 28) (figure 19B and figure 28D). While 1XX T cells demonstrated only a partial shift to a less differentiated T cell state, XX3 revealed higher levels of genes associated with naive / memory along with a systematic suppression of genes encoding master transcription factors for T cell differentiation and function effector (figures 19B-19D). These findings emphasize the important role of ITAM dosage and position to transmit different T cell destinations. They also support models of memory formation that position the cellular destination in the control of signaling intensity 2º,
[0384] [0384] Recent reports support the notion that less differentiated T cell subsets and memory characteristics are associated with greater anti-tumor efficacy, and persistence of adoptively transferred T cells º% * !, The results extend to these findings in demonstrating that T cell differentiation states can be controlled intrinsically by mutations in the CD3z chain of CAR T cells. The signaling domains CD28 and CD3z are forced in a 1: 1 stoichiometry in CARSs , differing from their natural space-time relationship *. Previous studies on CD37 mutations were limited to in vitro comparisons 2 -% * that did not reveal major effects, as opposed to the crucial consequences not revealed in vivo (figure 16). In vivo studies have shown that balance in T cell differentiation and acquisition of effector functions is essential to optimize the therapeutic effectiveness of CAR T cells, based on a comparison of different signaling motifs expressed from a constant genomic locus ( figures 18 and 19). This experimental adjustment is believed to be ideal for quantitative comparisons of CAR and TCR "º.
[0385] [0385] In summary, 1XX induced strong effector functions without shutting down the memory program, and surpassed 19287 under stress test conditions. The further reduction in the potential for T cell activation through XX3 resulted in very persistent T cells, but weak antitumor activity due to insufficient elicitation of effector functions. Notably, the ITAM configuration modified in 1XX favors the persistence of highly functional CARs, balancing the replicative capacity of long-term memory cells and the acquisition of efficient anti-tumor function. Preparations for clinical studies using the 1XX CAR project are in progress. METHODS
[0386] [0386] Cell lines and cultivation conditions. Were Nalm6 cells transduced to express green fluorescent protein (GFP) from firefly luciferase (FFLuc), and EL4 murine thymoma cells and NIH / 3T3 cells were transduced to express human CD19, in the manner previously described 2nd, The cells were tested regularly for Mycoplasma using the Mycoplasma detection kit MycoAlert (Lonza) and observed as negative.
[0387] [0387] Isolation and expansion of human T cells. White blood platelets from anonymous healthy donors were obtained from the New York Blood Center (exempt from the institutional review board) and peripheral blood was obtained from healthy volunteers. All blood samples were handled following the required ethical and safety procedures. Peripheral blood mononuclear cells were isolated by density gradient centrifugation, and activated with phytohemagglutinin (2 µg mL!) For experiments performed with retroviral vectors, or T cells were purified using the Pan T cell isolation kit (Miltenyi Biotec ) and stimulated with CD3 / CD28 T cell Activator Dynabeads (Invitrogen), as previously described ", and cultured in hematopoietic cell medium without serum X-VIVO 15 (Lonza), supplemented with 5% human serum (Gemini Bio-Products ), 5 ng mL "of interleukin-7 (IL7) and 5 ng mL"! Of IL15 (BioLegend) for experiments targeting the gene. The medium was changed every 2 days, and the cells were plated in 10th cells per ml.
[0388] [0388] For some experiments, cells (TOCR * CD62L * CCR7 * CD45RA * CD95 ”) naive, (TCR * CD62L * CCR7 * CD45RA * CD95 *) TSCM, and (TCR * CD62L-CCR7 CD45RA * CD95 *) Terr were classified by flow cytometry. The CAR cDNA was then targeted at the TRAC locus of classified naive T cells, followed by in vitro culture and negative TOR purification, as previously described. Seven days after gene targeting was performed, T cells were either stimulated with 3T3-CD19 for 24 hours for further analysis or injected into tumor-bearing mice.
[0389] [0389] Genetic modification of T cells. Plasmids encoding the retroviral vector SFGy * were prepared using standard molecular biology techniques, as previously described º. Retroviral supernatants pseudotyped with vesicular stomatitis virus G glycoprotein (VSV-G), derived from transduced gpg29 fibroblasts (H29), were used to build stable retrovirus-producing cell lines.
[0390] [0390] Has the synthesis of SFG-19287 been previously described 293 ”; comprises a single chain variable fragment, specific for human CD19, preceded by a leader CD8a peptide and followed by intracellular hinge-transmembrane regions trCD28, and intracellular domains mutated by CD36 or ITAM / deleted by CD36 linked to a P2A sequence for induce coexpression of truncated low-finite neural growth factor (LNGFR) receptor. Standard molecular biology techniques were used to construct the mutants
[0391] [0391] The gene targeting experiments were carried out in the manner previously described ", In summary, modified guide RNAs (RNAgs) targeting the first exon of the constant chain of the TRA'º gene and the messenger RNA (mRNA) Cas9 were synthesized by TriLink BioTechnologies pPAAV-TRAC-19287 was cloned based on a major part of pPAAV-GFP (Cell Biolabs) pAAV-TRAC-19287 contains 1.9 kb of genomic TRAC that flanks sequences targeting RNAg, a P2A peptide of autocleavage in alignment with the first TRAC exon, followed by the 19287 or 19287 mutant CAR, in the manner described above.The CAR cDNA is followed by the bovine growth hormone polyA signal.
[0392] [0392] CD3 / CD28 beads were removed magnetically 48 hours after the start of T cell activation. T cells were transfected by Cas9 RNAg RNA electrotransfer, using an AgilePulse MAX (BTX) system and the recombinant AAV6 donor vector ( manufactured by SignaGen Laboratories) was added to the culture after electroporation, in the manner previously described '. To obtain TCR negative T cells, TOR positive T cells were removed from the culture using biotin-anti-magnetic TCRa B, anti-biotin microspheres, and LS columns (Miltenyi Biotec).
[0393] [0393] Cytotoxicity tests. The cytotoxicity of T cells transduced with a CAR was determined by standard ºCr release assays and luciferase-based assays. For * ººCr release assays, EL4 that express CD19 were used as target cells, as previously described * . For luciferase-based assays, Nalm6 that express FFLuc-GFP functioned as target cells. The effector and tumor target cells were co-cultured in triplicates, in the indicated effector / target ratio, using 96-well plates with dark walls, with 5 x 10º target cells in a total volume of 100 µl per well in Nalm6 medium. The target cells alone were plated at the same cell density to determine the maximum luciferase expression (relative light unit (RLU)); after 18 hours, 100 µl of luciferase substrate (Bright-Glo; Promega) was added directly to each well. The emitted light was detected in a luminescence plate reader. Lysis was determined to be (1 - (RLU sample) / (RLUmax)) x 100.
[0394] [0394] Antigen stimulation and proliferation assays. Four days after transduction, CAR T cells were co-cultured with irradiated irradiated CD19 * NIH / 3T3, in 10th CAR * cells per mL, in 24-well tissue culture plates. Identical stimulations in fresh media were performed weekly. Total cells were counted and CAR expression was determined weekly by flow cytometry. Subsequently, T CAR cells were stimulated again under the same conditions.
[0395] [0395] Mouse systemic tumor model. Male NOD / SCID / IL-2Ry null mice aged 6 to 12 weeks (The Jackson Laboratory) were used in a protocol approved by the Memorial Sloan Kettering Cancer Center (MSKCC) Institutional Animal Care and Use Committee. All relevant animal use guidelines and ethical regulations have been followed. The mice were inoculated with 0.5 x 10 6 cells of FFLuc-GFP NALMG by injection into the caudal vein, followed by 5 x 10%, 1 x 105, or 5 x 10º T CAR cells injected 4 days later. The experiments with new exposure to the tumor were performed by intravenous administration of 0.5 x 106, 1 x 106º or 2 x 106 cells of FFLuc-GFP Nalm6 at intervals of 7 to 10 days, in the indicated period of time. Nalm6 produce a lot of tumor burden, and none of the mice were excluded before treatment. None of the randomization or masking methods were used. Bioluminescence imaging was performed using the IVIS imaging system (PerkinElmer), with the Living Image software (PerkinElmer), for the acquisition of imaging data sets. The tumor burden was assessed in the manner previously described *
[0396] [0396] RNA extraction, transcriptome sequencing and RNA-seq analysis. Seven days after the targeting of classified naïve T cells gene was performed, TRAC-19287, TRAC-XX3, and TRAC-1XX were stimulated with irradiated 3T3-CD19 for 24 hours, followed by magnetic selection of CD8 * cells (Miltenyi Biotec) . Washed T cells were resuspended in 250 μl of PBS and placed in 750 μl of TRIzol LS reagent (Thermo Fisher Scientific). The RNA was extracted using the RNeasy Mini kit (QIAGEN), according to the instructions provided by the manufacturer. After quantification of RiboGreen RNA and quality control using an Agilent Bioanalyzer, 500 ng of total RNA went through the selection with polyA and preparation of the TruSeg RNA library, according to the instructions provided by the manufacturer (TruSegq Stranded mRNA LT kit; Ilumina), with eight PCR cycles. The samples were classified in bar code and run in a HiSeq 4000 (Illumina), in a final paired run of 50 base pairs (bp) / 50 bp, using the HiSeq 3000/4000 SBS kit (Illumina). An average of 30.6 million paired readings was generated per sample. At most, ribosomal readings represented 4.69% of the total readings generated; the percentage of mRNA bases averaged 69.3%.
[0397] [0397] —FASTQ data issued were mapped to the target genome using the STAR RNA-seq strainer (version 2.5.0a; two-pass method) ”º,
[0398] [0398] The genes differentially expressed between T cell subsets (Tn, Tcm, Tscm, TeFF cells) were recovered from Gattinoni et al. . GSEA was performed using a pre-classified file generated by the use of log2 (fold change) in cured gene sets from the Broad Institute Molecular Signature Database (http://www.broadinstitute.org/gsea/ msigdb /) . The demonstrated gene signatures are derived from the gene sets of the immunological signatures C7, Reactome, KEGG and gene ontology (Biological Process). GSE41867 was used for the exhausted CD8 T cell GSEA versus nalive / memory, and to cure the signature of 200 increasingly regulated genes in exhausted CD8 T cells (day 30 after infection by the lifocytic choriomeningitis virus), with respect to the cells of memory and naive. Genes identified as differentially expressed between experimental conditions, with an adjusted P value <0.05 and absolute log2 (fold change)> 1, were used for gene ontology analysis using the R enrichR package (http: //amp.pharm . mssm.edu/Enrichr/).
[0399] [0399] Antibodies and intracellular staining. The following fluorophore-conjugated antibodies were used. From BD Biosciences: APC-Cy7 mouse anti-human CD8; APC-Cy7 mouse anti-human CD45; BUV395 mouse anti-human CDA4; Mouse anti-human CD4 PE; BB515 mouse anti-human CD4; BV421 mouse anti-human CD62L; BV650 mouse anti-human CDA45RA; BV421 mouse anti-human CD45RA; BV480 mouse anti-human CD279 (PD-1); BV650 mouse anti-human CD279 (PD-1); BUV737 mouse anti-human CD19; BV421 mouse anti-human TIM3 (CD366); BB515 mouse anti-human CD95; APC-H7 mouse anti-human CD27; Mouse anti-human CD271 PE (LNGFR). From BioLegend: APC anti-human CD8a; Anti-human APC / Cy7 CD62L; Anti-human FITC CD45RA; Anti-human CD366 Bright violet 785 (Tim-3); Anti-human CD127 PE (IL-7Ra); Alexa Fluor 488 anti-human CD127 (IL-7Ra); Anti-human CD197 PerCP / Cyanine5.5 (CCR7); Anti-human CD28 Brilliant Violet 650. From Invitrogen: Monoclonal antibody CD8a (RPA-T8), PE-Cyanine7; CD223 (LAG-3) monoclonal antibody (3DS223H) PerCP-eFluor 710; CD223 (LAG-3) Monoclonal antibody (3DS223H), APC; InvitrogenTCR monoclonal antibody alpha / beta (IP26), PE-Cyanine7. From Miltenyi Biotec: Human monocional Anti-TCRa / B-PE. 7-AAD (BD Biosciences) and LIVE / DEAD Fixable Violet Dead Cell (Invitrogen) staining kit were used as viability dyes.
[0400] [0400] For CAR staining, an F (ab ') 2 fragment of Alexa Fluor 647 AffiniPure goat anti-mouse IgG antibody specific F (ab') 2 fragment was used (Jackson ImmunoResearch). For cell counting, CountBright absolute counting beads were added (Invitrogen), according to the manufacturer's instructions. For in vivo experiments, Fc receptors were blocked using mouse FCcR blocking reagent (Miltenyi Biotec).
[0401] [0401] For the intracellular cytokine secretion assay, T cells were co-cultured with 3T3-CD19 or Nalm6 in the presence of the protein transport inhibitor Golgi Plug (BD Biosciences) for the last 4 hours. For staining with CD107a,
[0402] [0402] Flow cytometry was performed on an LSR instrument | or LSRFortessa (BD Biosciences), and a FACSAria classifier (BD Biosciences) was used for cell classification. The data were analyzed using FlowJo software v.10.1 (FlowJo LLC).
[0403] [0403] Statistical analysis. All statistical analyzes were performed using the Prism 7 (GraphPad) software. None of the statistical methods were used to pre-determine sample size. Statistical comparisons between two groups were determined by two-tailed parametric or non-parametric t-tests (Mann-Whitney U test) for unpaired data, or by two-tailed paired Student t-tests for combined samples. For in vivo experiments, complete survival was represented by a Kaplan-Meier curve and the Log-Rank test was used to compare differences in survival between groups. P values <0.05 were considered statistically significant. The statistical test used for each figure is described in the legend for the corresponding figure.
[0404] [0404] Summary of the report. Additional information on the research project is available in the summary of the report linked to the nature of the research in this article. DATA AVAILABILITY
[0405] [0405] The RNA-seq data has been deposited in the Gene Expression Omnibus and is available through accession number GSE121226. The raw data for the figures in the manuscript will be made available upon request to the corresponding author. REFERENCES
[0406] [0406] 1. Sadelain, M., Riviêre, |. & Riddell, S. Therapeutic T cell engineering. Nature 545, 423-431 (2017).
[0407] [0407] 2. Maher, J., Brentjens, R. J., Gunset, G., Riviêre, |. & Sadelain, M. Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta / CD28 receptor. Nat. Biotechnol. 20, 70—75 (2002).
[0408] [0408] 3. Brentjens, R. J. et al. CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute Iymphoblastic leukemia. Sci. Transl. Med. 5, 177ra38 (2013).
[0409] [0409] 4. Lee, D. W. et al. T cells expressing CD19 chimeric antigen receptors for acute Iymphoblastic leukaemia in children and young adults: a phase 1 dose- escalation trial. Lancet 385, 517—528 (2015).
[0410] [0410] 5. Park, J. H. et al. Long-term follow-up of CD19 CAR therapy in acute Iymphoblastic leukemia. N. Engl. J. Med. 378, 449459 (2018).
[0411] [0411] 6. Neelapu, S. S.etal. Axicabtagene Ciloleucel CAR T-cell therapy in refractory large B-cell lémémo. N. Engl. J. Med. 377, 2531-2544 (2017).
[0412] [0412] 7. Sadelain, M. CD19 CAR T cells. Cell 171, 1471 (2017).
[0413] [0413] 8. Zhao, Z.etal. Structural design of engineered costimulation determines tumor rejection kinetics and persistence of CAR T cells. Cancer Cell 28, 415428 (2015).
[0414] [0414] 9. Youngblood, B., Davis, C. W. & Ahmed, R. Making memories that last a lifetime: heritable functions of self-renewing memory CDB8 T cells. Int. Immunol. 22,
[0415] [0415] 10. Wherry, E. J. & Kurachi, M. Molecular and cellular insights into T cell exhaustion. Nat. Rev. Immunol. 15, 486499 (2015).
[0416] [0416] 11. Acuto, O. & Michel, F. CD28-mediated co-stimulation: a quantitative support for TCR signalling. Nat. Rev. Immunol. 3, 939—951 (2003).
[0417] [0417] 12. Smith-Garvin, J. E., Koretzky, G. A. & Jordan, M. S. cell activation. Annu. Rev. Immunol. 27, 591-619 (2009).
[0418] [0418] 13. Love, P. E. & Hayes, S. M. ITAM-mediated signaling by the T-cell antigen receptor. Cold Spring Harb. Perspect. Biol. 2, a002485 (2010).
[0419] [0419] 14. Kersh, E. N., Shaw, A. S. & Allen, P. M. Fidelity of T cell activation through multistep T cell receptor zeta phosphorylation. Science 281, 572—575 (1998).
[0420] [0420] 15. Isakov, N. et al. ZAP-70 binding specificity to T cell receptor tyrosine- based activation motifs: the tandem SH2 domains of ZAP-70 bind distinct tyrosine- based activation motifs with varying affinity. J. Exp. Med. 181, 375-380 (1995).
[0421] [0421] 16. van Oers, N. S. et al. The 21- and 23-kD forms of TCR zeta are generated by specific ITAM phosphorylations. Nat. Immunol. 1, 322—328 (2000).
[0422] [0422] 17. Chae, W. J. et al. Qualitatively differential regulation of T cell activation and apoptosis by T cell receptor zeta chain ITAMs and their tyrosine residues. / nt. Immunol. 16, 1225-1236 (2004).
[0423] [0423] 18. Mukhopadhyay, H., Cordoba, S. P., Maini, P. K., van der Merwe, P. A. & Dushek, O. Systems model of T cell receptor proximal signaling reveals emergent ultrasensitivity. PLoS Comput. Biol. 9, e1003004 (2013).
[0424] [0424] 19. Eyquem, J. et al. Targeting a CAR to the TRAC locus with CRISPR / Cas9 enhances tumor rejection. Nature 543, 113—117 (2017).
[0425] [0425] 20. Brentens, R. J. et al. Eradication of systemic B-cell tumors by genetically targeted human T Iymphocytes co-stimulated by CD80 and interleukin-15. Nat. Med. 9, 279—286 (2003).
[0426] [0426] 21. Gattinoni, L. et al. A human memory T cell subset with stem cell-like properties. Nat. Med. 17, 1290-1297 (2011).
[0427] [0427] 22. Chang, J. T., Wherry, E. J. & Goldrath, A. W. Molecular regulation of effector and memory T cell differentiation. Nat. Immunol. 15, 1104-1115 (2014).
[0428] [0428] 23. Yu, B. et al. Epigenetic landscapes reveal transcription factors that regulate CD8 * T cell differentiation. Nat. Immunol. 18, 573—-582 (2017).
[0429] [0429] 24. Kaech, S. M. & Cui, W. Transcriptional control of effector and memory CD8 * T cell differentiation. Nat. Rev. Immunol. 12, 749—761 (2012).
[0430] [0430] 25. Ichii, H. et al. Role for Bcl-6 in the generation and maintenance of memory CD8 * T cells. Nat. Immunol. 3, 558-563 (2002).
[0431] [0431] 26. Zhou, X. & Xue, H. H. Cutting edge: generation of memory precursors and functional memory CD8 * T cells depends on T cell factor-1 and Iymphoid enhancer-binding factor-1. J. Immunol. 189, 2722-2726 (2012).
[0432] [0432] 27. Carlson, C. M. et al. Kruppel-like factor 2 regulates thymocyte and T-cell migration. Nature 442, 299—302 (2006).
[0433] [0433] 28. Bai, A., Hu, H., Yeung, M. & Chen, J. Kruppel-like factor 2 controls T cell trafficking by activating L-selectin (CD62L) and sphingosine-1-phosphate receptor 1 transcription . J. Immunol. 178, 7632—7639 (2007).
[0434] [0434] 29. Daniels, M. A. & Teixeiro, E. TOR signaling in T cell memory. Front. Immunol. 6, 617 (2015).
[0435] [0435] 30. Fraietta, J. A. et al. Determinants of response and resistance to CD19 chimeric antigen receptor (CAR) T cell therapy of chronic Iymphocytic leukemia. Nat. Med. 24, 563—571 (2018).
[0436] [0436] 31. Sommermeyer, D. et al. Chimeric antigen receptor-modified T cells derived from defined CD8 * and CD4 * subsets confer superior antitumor reactivity in vivo. Leukemia 30, 492—500 (2016).
[0437] [0437] 32. Zhao, Y. et al. A herceptin-based chimeric antigen receptor with modified signaling domains leads to enhanced survival of transduced T Iymphocytes and antitumor activity. J. Immunol. 183, 5563-5574 (2009).
[0438] [0438] 33. James, J. R. Tuning ITAM multiplicity on T cell receptors can control potency and selectivity to ligand density. Sci. Signal. 11, eaan1088 (2018).
[0439] [0439] 34. Kochenderfer, J. N., Yu, Z., Frasheri, D., Restifo, N. P. & Rosenberg, S. A. Adoptive transfer of syngeneic T cells transduced with a chimeric antigen receptor that recognizes murine CD19 can eradicate lymphoma and normal B cells. Blood 116, 3875-3886 (2010).
[0440] [0440] 35. Riviêre, |., Brose, K. & Mulligan, R. C. Effects of retroviral vector design on expression of human adenosine deaminase in murine bone marrow transplant recipients engrafted with genetically modified cells. Proc. Natl Acad. Sci. USA 92, 6733-6737 (1995).
[0441] [0441] 36. Gong, M. C. et al. Cancer patient T cells genetically targeted to prostate-specific membrane antigen specifically Iyse prostate cancer cells and release cytokines in response to prostate-specific membrane antigen. Neoplasia 1, 123—127 (1999).
[0442] [0442] 37. Brentjens, R. J. et al. Genetically targeted T cells eradicate systemic acute Iymphoblastic leukemia xenografts. Clin. Cancer Res. 13, 5426-5435 (2007).
[0443] [0443] 38. Ghosh, A. et al. Adoptively transferred TRAIL * T cells suppress GVHD and augment antitumor activity. J. Clin. Invest. 123, 2654-2662 (2013).
[0444] [0444] 39. Gade, T. P. et al. Targeted elimination of prostate cancer by genetically directed human T Iymphocytes. Cancer Res. 65, 9080-9088 (2005).
[0445] [0445] 40. Dobin, A. et al. STAR: ultrafast universal RNA-seq aligner. Bioinformatics 29, 15—21 (2013). MODALITIES OF THE SUBJECT ISSUE CURRENTLY IN ISSUE DESCRIBED
[0446] [0446] From the preceding description, it will be evident that variations and modifications can be made regarding the subject in question currently described to adopt the same in various uses and conditions. Such modalities are also within the scope of the following claims.
[0447] [0447] Quoting a list of elements in any definition of a variable here includes definitions of that variable as any single element or combination (or sub-combination) of listed elements. The recitation of a modality here includes this modality as any simple modality, or in combination with any other modalities or portions thereof.
[0448] [0448] All patents and publications mentioned in this specification are hereby incorporated by reference to the same extent, as if each independent patent and publication were specifically and individually indicated to be incorporated by the reference.

权利要求:
Claims (139)
[1]
1. Chimeric antigenic receptor (CAR) comprising an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD37 polypeptide, characterized in that the modified CD37 polypeptide lacks all or part of the reasons for immunoreceptor activation tyrosine base (ITAMs), where ITAMs are ITAM1, ITAM2 and ITAM3.
[2]
2. CAR according to claim 1, characterized in that the modified CD36 polypeptide lacks ITAM2 or a portion thereof.
[3]
3. CAR according to claim 2, characterized in that the modified CD36 polypeptide additionally lacks ITAM3 or a portion thereof.
[4]
4. CAR according to claim 2, characterized in that the modified CD36 polypeptide additionally lacks ITAM1 or a portion thereof.
[5]
5. CAR according to claim 1, characterized in that the modified CD36 polypeptide lacks ITAM1 or a portion thereof.
[6]
6. CAR according to claim 5, characterized in that the modified CD36 polypeptide additionally lacks ITAM3 or a portion thereof.
[7]
7. CAR according to claim 1, characterized in that the modified CD37 polypeptide lacks ITAM3 or a portion thereof.
[8]
8. CAR according to claim 1, characterized in that the modified CD36 polypeptide comprises an ITAM2 elimination or a portion thereof.
[9]
CAR according to claim 8, characterized in that the modified CD36 polypeptide additionally comprises an ITAM3 elimination or a portion thereof.
[10]
10. CAR according to claim 8, characterized in that the modified CD37 polypeptide further comprises an elimination of ITAM1 or a portion thereof.
[11]
11. CAR according to claim 1, characterized in that the modified CD376 polypeptide comprises an ITAM1 elimination or a portion thereof.
[12]
CAR according to claim 11, characterized in that the modified CD37 polypeptide additionally comprises an ITAM3 elimination or a portion thereof.
[13]
13. CAR according to claim 1, characterized in that the modified CD37 polypeptide comprises an ITAM3 elimination or a portion thereof.
[14]
14. CAR according to any one of claims 1-13, characterized in that the modified CD37 polypeptide lacks all or part of the regions of rich basic extension (BRS), in which the BRS regions are BRS1, BRS2 and BRS3.]
[15]
15. CAR according to claim 14, characterized in that the modified CD37 polypeptide lacks BRS2 or a portion thereof.
[16]
16. CAR according to claim 15, characterized in that the modified CD36 polypeptide additionally lacks BRS3 or a portion thereof.
[17]
17. CAR according to claim 16, characterized in that the modified CD36 polypeptide additionally lacks BRS1 or a portion thereof.
[18]
18. CAR according to claim 14, characterized in that the modified CD37 polypeptide lacks BRS1 or a portion thereof.
[19]
19. CAR according to claim 18, characterized in that the modified CD36 polypeptide additionally lacks BRS3 or a portion thereof.
[20]
20. CAR according to claim 14, characterized in that the modified CD36 polypeptide lacks BRS3 or a portion thereof.
[21]
21. CAR according to claim 14, characterized in that the modified CD36 polypeptide lacks BRS1 or a portion thereof, BRS2 or a portion thereof, and BRS3 or a portion thereof.
[22]
22. CAR according to claim 1, characterized in that the modified CD37 polypeptide lacks ITAM2, ITAM3, BRS2 and BRS3.
[23]
23. CAR according to claim 14, characterized in that the modified CD36 polypeptide comprises an elimination of BRS2 or a portion thereof.
[24]
24. CAR according to claim 23, characterized in that the modified CD36 polypeptide further comprises an elimination of BRS3 or a portion thereof.
[25]
25. CAR according to claim 24, characterized in that the modified CD36 polypeptide further comprises an elimination of BRS1 or a portion thereof.
[26]
26. CAR according to claim 14, characterized in that the modified CD36 polypeptide comprises an elimination of BRS1 or a portion thereof.
[27]
27. CAR according to claim 26, characterized in that the modified CD36 polypeptide further comprises an elimination of BRS3 or a portion thereof.
[28]
28. CAR according to claim 14, characterized in that the modified CD36 polypeptide comprises an elimination of BRS3 or a portion thereof.
[29]
29. CAR according to claim 14, characterized in that the modified CD36 polypeptide comprises an elimination of BRS1 or a portion thereof, BRS2 or a portion thereof, and BRS3 or a portion thereof.
[30]
30. CAR according to claim 1, characterized in that the modified CD36 polypeptide comprises an elimination of ITAM2, ITAM3, BRS2 and BRS3.
[31]
31. CAR according to claim 1, characterized in that the CAR comprises the amino acid sequence shown in SEQ ID NO: 45 or SEQ ID NO: 47.
[32]
32. Chimeric antigenic receptor (CAR) comprising an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, characterized in that the modified CD37 polypeptide lacks all or part of the regions of rich basic extension (BRS), where the BRS regions are BRS1, BRS2 and BRS3.
[33]
33. CAR according to claim 32, characterized in that the modified CD37 polypeptide lacks BRS2 or a portion thereof.
[34]
34. CAR according to claim 33, characterized in that the modified CD36 polypeptide additionally lacks BRS3 or a portion thereof.
[35]
35. CAR according to claim 34, characterized in that the modified CD36 polypeptide additionally lacks BRS1 or a portion thereof.
[36]
36. CAR according to claim 35, characterized in that the modified CD37 polypeptide lacks BRS1 or a portion thereof.
[37]
37. CAR according to claim 36, characterized in that the modified CD36 polypeptide additionally lacks BRS3 or a portion thereof.
[38]
38. CAR according to claim 37, characterized in that the modified CD37 polypeptide lacks BRS3 or a portion thereof.
[39]
39. CAR according to claim 32, characterized in that the modified CD36 polypeptide lacks BRS1 or a portion thereof, BRS2 or a portion thereof, and BRS3 or a portion thereof.
[40]
40. Chimeric antigenic receptor (CAR) comprising an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, characterized in that the modified CD37 polypeptide comprises a variation of BRS selected from a variation of BRS1, a variation of BRS2, and a variation of BRS3, in which the variation of BRS comprises one or more mutations with loss of function.
[41]
41. CAR according to any one of claims 1-40, further comprising a hinge / spacer region, characterized in that the hinge / spacer region comprises a CD8 polypeptide, a CD28 polypeptide, a CD36 polypeptide, a CD4 polypeptide, a 4- 1BB polypeptide, OX40 polypeptide, CD166 polypeptide, CD166 polypeptide, CD8a polypeptide, CD8b polypeptide, ICOS polypeptide, ICAM-1 polypeptide, CTLAH polypeptide, CD27 polypeptide, CD40 / My88 polypeptide NKGD2 peptide, or a combination thereof.
[42]
42. CAR according to claim 41, characterized in that the hinge / spacer region comprises a CD166 polypeptide.
[43]
43. CAR according to claim 42, characterized in that the CD166 polypeptide has amino acids 489 to 527 of SEQ ID NO: 3.
[44]
44, Chimeric antigenic receptor (CAR) comprising an extracellular antigen binding domain, a hinge / spacer region, a transmembrane domain, and an intracellular signaling domain comprising a modified CD37 polypeptide, characterized in that the modified CD36 polypeptide comprises one or more ITAM variations comprising one or more mutations with loss of function, where each of the one or more ITAM variations is independently selected from the group consisting of a variation of ITAM1, a variation of ITAM2, and a variation of ITAM3, and in that the hinge / spacer region comprises a CD8 polypeptide, a CD28 polypeptide, a CD367 polypeptide, a CD4 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, a CD166 polypeptide, a CD166 polypeptide, a CD8 polypeptide, a CD8 polypeptide, a polypeptide, a polypeptide an ICOS polypeptide, an ICAM-1 polypeptide, a CTLA-4 polypeptide, a CD27 polypeptide, a CD40 / My88 peptide, an NKGD2 peptide, or one with combination.
[45]
45. The method of claim 44, characterized in that the modified CD36 polypeptide comprises a variation of ITAM2 and a variation of ITAM3.
[46]
46. Method according to claim 45, characterized in that the variation of ITAM2 has the amino acid sequence shown in SEQ ID NO: 29.
[47]
47. Method according to claim 45 or 46, characterized in that the variation of ITAM3 has the amino acid sequence shown in SEQ ID NO: 33.
[48]
48. CAR according to any one of claims 44-47, characterized in that the modified CD36 polypeptide comprises or consists of amino acids 374 to 485 of SEQ ID NO: 43.
[49]
49. CAR according to any one of claims 44-48, characterized in that the CAR comprises the amino acid sequence shown in SEQ ID NO: 43.
[50]
50. Method according to any of claims 45-49, characterized in that both the variation of ITAM2 and the variation of ITAM3 comprise two mutations with loss of function.
[51]
51. Method according to any one of claims 44-50, characterized in that the one or more loss-of-function mutation is a tyrosine amino acid residue.
[52]
52. CAR according to any one of claims 1-51, characterized in that the transmembrane domain comprises a CD8 polypeptide, a CD28 polypeptide, a CD36 polypeptide, a CD4 polypeptide, a 4- 1BB polypeptide, an OX40 polypeptide, a CD166 polypeptide , a CD166 polypeptide, CD8a polypeptide, CD8b polypeptide, ICOS polypeptide, ICAM-1 polypeptide, CTLAH polypeptide, CD27 polypeptide, CD40 / My88 peptide, NKGD2 peptide, or a combination thereof.
[53]
53. CAR according to claim 52, characterized in that the transmembrane domain comprises a CD166 polypeptide.
[54]
54. CAR according to claim 53, characterized in that the CD166 polypeptide comprises amino acid 528 to 553 of SEQ ID NO: 3.
[55]
55. CAR according to any one of claims 44-54, characterized in that the transmembrane domain and the hinge / spacer region are derived from the same molecule.
[56]
56. CAR according to any one of claims 44-55, characterized in that the hinge / spacer region comprises a CD28 polypeptide and the transmembrane domain comprises a CD28 polypeptide.
[57]
57. CAR according to any one of claims 44-56, characterized in that the hinge / spacer region comprises a CD84 polypeptide and the transmembrane domain comprises a CD84 polypeptide.
[58]
58. CAR according to any one of claims 44-57, characterized in that the hinge / spacer region comprises a CD166 polypeptide and the transmembrane domain comprises a CD166 polypeptide.
[59]
59. CAR according to claim 58, characterized in that the CAR comprises amino acids 489 to 553 of SEQ ID NO: 3.
[60]
60. CAR according to any one of claims 44-59, characterized in that the hinge / spacer region comprises a CD8a polypeptide and the transmembrane domain comprises a CD8a polypeptide.
[61]
61. CAR according to any one of claims 44-60, characterized in that the hinge / spacer region comprises a CD8b polypeptide and the transmembrane domain comprises a CD8b polypeptide.
[62]
62. CAR according to any one of claims 44-54, characterized in that the transmembrane domain and the hinge / spacer region are derived from different molecules.
[63]
63. CAR according to claim 62, characterized in that the hinge / spacer region comprises a CD28 polypeptide and the transmembrane domain comprises an ICOS polypeptide.
[64]
64. CAR according to any one of claims 1-63, characterized in that the intracellular signaling domain additionally comprises a co-stimulatory signaling domain.
[65]
65. CAR according to claim 65, characterized in that the co-stimulatory signaling domain comprises a CD28 polypeptide.
[66]
66. Immunoresponsive cell, characterized by comprising a CAR, according to any one of claims 1-65.
[67]
67. Immunoresponsive cell according to claim 66, characterized in that the CAR is expressed recombinantly.
[68]
68. Immunoresponsive cell according to claim 66 or 67, characterized in that the CAR is expressed from a vector.
[69]
69. Immunoresponsive cell according to any of claims 66-68, characterized in that the CAR is placed in an endogenous gene locus of the immunoresponsive cell.
[70]
70. Immunoresponsive cell according to claim 69, characterized in that the endogenous gene locus is a TRAC locus, a TRBC locus or a TRGC locus.
[71]
71. Immunoresponsive cell according to claim 69 or 70, characterized in that the endogenous gene locus is a TRAC locus.
[72]
72. Immunoresponsive cell according to any of claims 69-71, characterized in that the positioning of the CAR interrupts or cancels the endogenous expression of a TCR.
[73]
73. Immunoresponsive cell according to any one of claims 66-72, characterized in that the cell is selected from the group consisting of a T cell, a natural killer cell (NK), a cytotoxic T lymphocyte (CTL), a T cell regulatory, a natural killer T cell (NKT), a myeloid cell, a human embryonic stem cell, and a pluripotent stem cell from which lymphoid cells can be differentiated.
[74]
74. Immunoresponsive cell according to any one of claims 66-73, characterized in that said immunoresponsive cell is autologous.
[75]
75. Immunoresponsive cell according to any one of claims 66-74, characterized in that said antigen is a tumor antigen.
[76]
76. Immunoresponsive cell according to claim 75, characterized in that the tumor antigen is selected from the group consisting of CD19, MUC16, MUC1, CAIX, CEA, CD8, CD7, CD10, CD20, CD22, CD30, CLL1, CD33 , CD34, CD38, CD41, CD44, CD49f, CD56, CD74, CD133, CD138, EGP-2, EGP-40, EpDpCAM, erb-B2,3,4, FBP, fetal acetylcholine receptor, folate receptor-GD2 , GD3, HER-2, hTERT, IL-13R-a2, K light chain, KDR, LeY, cell adhesion molecule L1, MAGE-A1, Mesothelin, ERBB2, MAGEA3, p53, MART1, GP100, Proteinase3 (PR1), Tyrosinase, Survivin, NTERT, EphA2, NKG2D ligands, NY-ES0-1, oncofetal antigen (h5T4), PSCA, PSMA, ROR1, TAG-72, VEGF-R2, WT-1, BCMA, CD123, CD44V6, NKCS1, EGFIR, EGFR-VIII, and CD99, CD70, ADGRE2, CCR1, LILRB 2, PRAME, CCRA4, CD5, CD3, TRBC1, TRBC2, TIM-3, Integrin B7, ICAM-1, CD70, Tim3, CLEC12A and ERBB.
[77]
77. Immunoresponsive cell according to claim 77, characterized in that said antigen is CD19.
[78]
78. Pharmaceutical composition, characterized in that it comprises an efficient amount of an immunoresponsive cell according to any one of claims 66-77, and a pharmaceutically acceptable excipient.
[79]
79. Pharmaceutical composition according to claim 78, characterized in that it is for treating a neoplasm.
[80]
80. Method for reducing tumor burden in a subject, characterized in that the method comprises administering to the subject an efficient amount of the immunoresponsive cells according to any one of claims 66-77, or the pharmaceutical composition according to claim 78 or 79.
[81]
81. Method for reducing the tumor burden in a subject, the method comprising administering to the subject an efficient amount of immunoresponsive cells or a pharmaceutical composition comprising them,
characterized in that the immunoresponsive cells comprise: a chimeric antigenic receptor (CAR) comprising an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, wherein the modified CD37 polypeptide comprises one or more variations ITAM comprising one or more mutations with loss of function, in which each of the one or more ITAM variations is independently selected from the group consisting of a variation of ITAM1I, a variation of ITAM2 and a variation of ITAM3.
[82]
82. The method of claim 81 or 82, characterized in that the method reduces the number of tumor cells.
[83]
83. The method of claim 81-83, characterized in that the method reduces the size of the tumor.
[84]
84. Method according to any of claims 81-84, characterized in that the method eradicates the tumor in the subject.
[85]
85. Method for treating or preventing a neoplasm, characterized in that the method comprises administering to the subject an efficient amount of the immunoresponsive cells according to any one of claims 66-77, or the pharmaceutical composition according to claim 78 or 79.
[86]
86. Method for treating or preventing a neoplasm, the method comprising administering to the subject an efficient amount of immunoresponsive cells or a pharmaceutical composition comprising them, characterized in that the immunoresponsive cells comprise: a chimeric antigenic receptor (CAR) comprising a binding domain of extracellular antigen, a transmembrane domain, and an intracellular signaling domain comprising a modified CD376 polypeptide, wherein the modified CD36 polypeptide comprises one or more ITAM variants comprising one or more loss-of-function mutations, each of which one or more variations ITAM is independently selected from the group consisting of a variation of ITAM1I, a variation of ITAM2 and a variation of ITAM3.
[87]
87. Method according to any one of claims 80-86, characterized in that the neoplasm or tumor is selected from the group consisting of blood cancer, B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia , non-Hodgkin's lymphoma and ovarian cancer.
[88]
88. Method according to any one of claims 80-87, characterized in that the neoplasm is B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, or non-Hodgkin's lymphoma, and the CAR binds to the CD19.
[89]
89. Method according to any one of claims 80-87, characterized in that the neoplasm is B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, or non-Hodgkin's lymphoma, and the CAR binds to the BCMA, ADGRE2, MSLN, PSMA or combinations thereof.
[90]
90. Method for treating a subject with a recurrence of a neoplasm, characterized in that the subject has a recurrence of a disease, in which the subject has received treatment leading to the residual tumor cell, or the subject has received an immunoresponsive cell comprising a receptor that recognizes antigen, wherein the antigen-recognizing receptor comprises a 4-1BB costimulatory signal, the method comprising administering to the subject an efficient amount of the immunoresponsive cells according to any one of claims 66-77 or the pharmaceutical composition according to the claim 78 or 79.
[91]
91. Method for treating a subject with a recurrence of a neoplasm, characterized in that the subject has a recurrence of a disease, in which the subject received treatment that leads to residual tumor cells, or the subject received an immunoresponsive cell comprising a receptor that recognizes antigen, wherein the antigen-recognizing receptor comprises a 4-1BB costimulatory signal, the method comprising administering to the subject an efficient amount of immunoresponsive cells or a pharmaceutical composition comprising them,
wherein the immunoresponsive cells comprise: a chimeric antigen receptor (CAR) comprising an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, wherein the modified CD37 polypeptide comprises one or more variations ITAM comprising one or more mutations with loss of function, where each one or more ITAM variations is independently selected from the group consisting of a variation of ITAM1, a variation of ITAM2 and a variation of ITAM3.
[92]
92. Method according to claim 90 or 91, characterized in that the neoplasm is selected from the group consisting of blood cancer, B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia and non-Hodgkin's lymphoma .
[93]
93. Method according to any of claims 90-92, characterized in that the neoplasm is B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, or non-Hodgkin's lymphoma, and the CAR binds to CD19.
[94]
94. Method according to claim 90-93, characterized in that the neoplasm is ALL CD19 +.
[95]
95. The method of claim 90-94, characterized in that the neoplasm comprises a tumor cell with a low density of a tumor specific antigen on the surface of the tumor cell.
[96]
96. Immuno-responsive cells according to any of claims 66-77, or the pharmaceutical composition according to claim 78 or 79, characterized in that they are for use in reducing tumor burden, treating or preventing a neoplasm, and / or treatment of a subject with a recurrence of a neoplasm.
[97]
97. Chimeric antigenic receptor (CAR) comprising an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain comprising a modified CD36 polypeptide, wherein the modified CD37 polypeptide comprises one or more ITAM variants comprising one or more mutations with loss of function, characterized by each one or more ITAM variations being independently selected from the group consisting of a variation of ITAM1, a variation of ITAM2, and a variation of ITAM3 for use in reducing tumor burden, treatment or prevention of a neoplasm, and / or treatment of a subject with a recurrence of a neoplasm.
[98]
98. Method for producing an antigen-specific immunoresponsive cell, characterized in that the method comprises introducing into a immunoresponsive cell a nucleic acid sequence encoding a CAR according to any one of claims 1-65.
[99]
99. Method according to claim 98, characterized in that the nucleic acid sequence is comprised of a vector.
[100]
100. Method according to claim 99, characterized in that the vector is a retroviral vector.
[101]
101. Isolated nucleotide acid, characterized by encoding the CAR according to any one of claims 1-65.
[102]
102. Isolated nucleotide acid according to claim 101, characterized in that it comprises the nucleotide sequence shown in SEQ ID NO: 45 and SEQ ID NO: 47.
[103]
103. Nucleic acid composition, characterized in that it comprises a CAR according to any one of claims 1-65.
[104]
104. Nucleic acid composition according to claim 103, characterized in that the nucleic acid sequences are comprised in a vector.
[105]
105. Nucleic acid composition according to claim 104, characterized in that the vector is a retroviral vector.
[106]
106. Vector, characterized in that it comprises the nucleic acid composition according to any one of claims 103-105.
[107]
107. Kit, characterized in that it comprises a CAR according to any one of claims 1-65, an immunoresponsive cell according to any one of claims 66-77, a pharmaceutical composition according to claim 78 or 79, an acid composition nucleic acid according to any one of claims 103-105, or a vector according to claim 106.
[108]
108. Kit according to claim 107, characterized in that the Kit further comprises written instructions for treating and / or preventing a neoplasm, a pathogen infection, an autoimmune disorder, or an allogeneic transplant.
[109]
109. An immunoresponsive cell comprising a) a first CAR comprising a first extracellular antigen binding domain that binds a first antigen, a first transmembrane domain, and a first intracellular signaling domain; and b) a second CAR comprising a second extracellular antigen binding domain that binds to a second antigen, a second transmembrane domain, and a second intracellular signaling domain, characterized in that the first CAR is a CAR according to any of the claims 1-65 or the first intracellular signaling domain comprises a modified CD36 polypeptide, which comprises one or more ITAM variants comprising one or more loss-of-function mutations, each of which one or more ITAM variations is independently selected from the group consisting of a variation of ITAM1I, a variation of ITAM2 and a variation of ITAM3.
[110]
110. Immunoresponsive cell according to claim 109, characterized in that the second CAR is a CAR according to any of claims 1-65.
[111]
111. Immunoresponsive cell according to claim 109, characterized in that the second intracellular signaling domain of the second CAR comprises a modified CD37 polypeptide, which comprises one or more ITAM variations comprising one or more mutations with loss of function, in which each one of the one or more ITAM variations is independently selected from the group consisting of a variation of ITAM1, a variation of ITAM2 and a variation of ITAM3.
[112]
112. Immunoresponsive cell according to claim 109, characterized in that the second intracellular signaling domain of the second CAR comprises a modified CD376 polypeptide, which is the same as the modified CD37 polypeptide comprised in the first intracellular signaling domain of the first CAR.
[113]
113. Immunoresponsive cell according to claim 109, characterized in that the second intracellular signaling domain of the second CAR comprises a modified CD36 polypeptide, which is different from the modified CD37 polypeptide comprised in the first intracellular signaling domain of the first CAR.
[114]
114. Immunoresponsive cell according to claim 109, characterized in that the second intracellular signaling domain of the second CAR comprises a natural CD36 polypeptide.
[115]
115. Immunoresponsive cell according to any of claims 109-113, characterized in that the first intracellular signaling domain of the first CAR is the same as the second intracellular signaling domain of the second CAR.
[116]
116. Immunoresponsive cell according to any of claims 109-114, characterized in that the first intracellular signaling domain of the first CAR is different from the second intracellular signaling domain of the second CAR.
[117]
117. Immunoresponsive cell according to any of claims 109-116, characterized in that the first antigen is different from the second antigen.
[118]
118. Immunoresponsive cell according to any of claims 109-117, characterized in that the first CAR additionally comprises a first hinge / spacer region.
[119]
119. Immunoresponsive cell according to any of claims 109-118, characterized in that the second CAR additionally comprises a second hinge / spacer region.
[120]
120. Immunoresponsive cell according to any of claims 109-119, characterized in that the first intracellular signaling domain comprises or exhibits a variation of ITAM2 and a variation of ITAM3, and the second intracellular signaling domain comprises or exhibits a deletion of ITAM2 or a portion of it, and an elimination of ITAM3 or a portion of it.
[121]
121. Immunoresponsive cell according to any of claims 109-119, characterized in that the first intracellular signaling domain comprises or presents a variation of ITAM2 and a variation of ITAM3, and the second intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM2.
[122]
122. Immunoresponsive cell according to any of claims 109-121, characterized in that it further comprises a third CAR comprising a third extracellular antigen binding domain that binds a third antigen, a third transmembrane domain, and a third domain intracellular signaling.
[123]
123. Immunoresponsive cell according to claim 122, characterized in that the first intracellular signaling domain comprises or presents a variation of ITAM2 and a variation of ITAM3, the second intracellular signaling domain comprises or presents an elimination of ITAM2 or a portion of the same, and an elimination of ITAM3 or a portion thereof, and the third intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM2.
[124]
124. Immunoresponsive cell according to claim 122, characterized in that the first intracellular signaling domain comprises or has an ITAM2 elimination or a portion thereof, and an ITAM3 elimination or a portion thereof, the second intracellular signaling domain comprise or present an ITAM2 elimination or a portion thereof, and an ITAM3 elimination or a portion thereof, and the third intracellular signaling domain comprises or exhibits a variation of ITAM1 and a variation of ITAM2.
[125]
125. An immunoresponsive cell according to claim 122, characterized in that the first intracellular signaling domain comprises or presents an elimination of ITAM2 or a portion thereof, and an elimination of ITAM3 or a portion thereof, the second intracellular signaling domain understand or present a variation of ITAM1 and a variation of ITAM2, and the third domain of intracellular signaling comprises or presents a variation of ITAM1 and a variation of ITAM2.
[126]
126. Immunoresponsive cell according to claim 122, characterized in that the first intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM2, the second intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM1 ITAM2, and the third intracellular signaling domain comprises or presents a variation of ITAM1 and a variation of ITAM2.
[127]
127. Pharmaceutical composition, characterized in that it comprises an efficient amount of an immunoresponsive cell according to any one of claims 109-126 and a pharmaceutically acceptable excipient.
[128]
128. Immuno-responsive cells according to any of claims 109-126, or the pharmaceutical composition according to claim 127, characterized in that they are for use in reducing tumor burden, treating or preventing a neoplasm, and / or treating a subject with a recurrence of a neoplasm.
[129]
129. Method for reducing tumor burden in a subject, characterized in that the method comprises administering to the subject an efficient amount of the immunoresponsive cells, according to any one of claims 109-126, or the pharmaceutical composition according to claim 127.
[130]
130. The method of claim 129, characterized in that the method reduces the number of tumor cells, reduces the size of the tumor, and / or eradicates the tumor in the subject.
[131]
131. Method for treating or preventing a neoplasm, characterized in that the method comprises administering to the subject an efficient amount of the immunoresponsive cells according to any one of claims 109-126, or the pharmaceutical composition according to claim 127.
[132]
132. Method according to claim 131, characterized in that the neoplasm or tumor is selected from the group consisting of blood cancer, B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, non-Hodgkin's lymphoma and ovarian cancer.
[133]
133. Method according to claim 131 or 132, characterized in that the neoplasm is B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, or non-Hodgkin's lymphoma, and the CAR binds to CD19.
[134]
134. Method according to any one of claims 131-133, characterized in that the neoplasm is B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, or non-Hodgkin's lymphoma, and the CAR binds to BCMA, ADGRE2, MSLN, PSMA or combinations thereof.
[135]
135. Method for treating a subject with a recurrence of a neoplasm, characterized in that the subject has a recurrence of a disease, in which the subject received treatment leading to residual tumor cells, or the subject received an immunoresponsive cell comprising a receptor that recognizes antigen, wherein the antigen-recognizing receptor comprises a 4-1BB costimulatory signal, the method comprising administering to the subject an efficient amount of the immunoresponsive cells according to any one of claims 109-126 or the pharmaceutical composition according to the claim 127.
[136]
136. Method according to claim 135, characterized in that the neoplasm is selected from the group consisting of blood cancer, B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia and non-Hodgkin's lymphoma.
[137]
137. Method according to claim 135 or 136, characterized in that the neoplasm is B cell leukemia, multiple myeloma, acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia, or non-Hodgkin's lymphoma, and the CAR binds to CD19.
[138]
138. Method according to claim 135-137, characterized in that the neoplasm is ALL CD19 +,
[139]
139. Method according to claim 135-138, characterized in that the neoplasm comprises a tumor cell with a low density of a tumor specific antigen on the surface of the tumor cell.

类似技术:

---

公开号 | 公开日 | 专利标题

---

BR112020012039A2|2020-11-24|improved chimeric antigenic receptors and uses thereof

---

US11267901B2|2022-03-08|Compositions and methods for immunotherapy

---

US20210214415A1|2021-07-15|Immunoresponsive cells expressing dominant negative fas and uses thereof

---

US20190151363A1|2019-05-23|Compositions and methods for immunotherapy

---

US20200330574A1|2020-10-22|Il-36 secreting immunoresponsive cells and uses thereof

---

CA3082611A1|2019-05-23|Methods and compositions for alleviating cytokine release syndrome

---

BR112020016138A2|2020-12-15|T-CELL RECEPTORS NOT RESTRICTED TO HLA AND USES OF THE SAME

---

US20200399598A1|2020-12-24|Il-33 secreting immunoresponsive cells and uses thereof

---

US20210236554A1|2021-08-05|Low dose radiation conditioning for immunotherapy

---

US20210171601A1|2021-06-10|Leucine zipper-based compositions and methods of use

---

WO2021113432A1|2021-06-10|Cells expressing c-kit mutations and uses thereof

---

WO2021141985A1|2021-07-15|Novel dominant negative fas polypeptides, cells comprising thereof and uses thereof

---

WO2019178207A1|2019-09-19|Phosphatidylserine targeting agents and uses thereof for adoptive t-cell therapies

同族专利:

---

公开号 | 公开日

---

CA3085606A1|2019-07-04|

---

WO2019133969A2|2019-07-04|

---

WO2019133969A3|2019-08-08|

---

EP3732191A4|2021-12-22|

---

KR20200106051A|2020-09-10|

---

SG11202006050XA|2020-07-29|

---

EP3732191A2|2020-11-04|

---

US20200317777A1|2020-10-08|

---

IL275619D0|2020-08-31|

---

WO2019133969A8|2020-06-25|

---

CN111886242A|2020-11-03|

---

JP2021509016A|2021-03-18|

---

AU2018394353A1|2020-07-09|

引用文献:

---

公开号 | 申请日 | 公开日 | 申请人 | 专利标题

---

---

US9273283B2|2009-10-29|2016-03-01|The Trustees Of Dartmouth College|Method of producing T cell receptor-deficient T cells expressing a chimeric receptor|

---

EP2828290B1|2012-03-23|2018-08-15|The United States of America, represented by the Secretary, Department of Health and Human Services|Anti-mesothelin chimeric antigen receptors|

---

CN105874061B|2013-02-26|2021-08-10|纪念斯隆-凯特琳癌症中心|Compositions and methods for immunotherapy|

---

CN105246504A|2013-03-15|2016-01-13|纪念斯隆-凯特琳癌症中心|Compositions and methods for immunotherapy|

---

US11072644B2|2014-11-12|2021-07-27|Allogene Therapeutics, Inc.|Inhibitory chimeric antigen receptors|

---

US20190330302A1|2017-01-10|2019-10-31|The General Hospital Corporation|Chimeric antigen receptors based on alternative signal i domains|CN105384825B|2015-08-11|2018-06-01|南京传奇生物科技有限公司|A kind of bispecific chimeric antigen receptor and its application based on single domain antibody|

---

AU2020226401A1|2019-02-18|2021-10-14|Memorial Sloan-Kettering Cancer Center|Combinations of multiple chimeric antigen receptors for immunotherapy|

---

WO2021013950A1|2019-07-23|2021-01-28|Mnemo Therapeutics|Immune cells defective for suv39h1|

---

CN110452294B|2019-08-06|2020-08-07|复旦大学|Five hinge regions and chimeric antigen receptors and immune cells thereof|

---

TW202122575A|2019-08-28|2021-06-16|大陸商南京傳奇生物科技有限公司|Engineered t cells and methods of producing thereof|

---

SG10201908256RA|2019-09-06|2021-04-29|Nat Univ Singapore|T cell modified with a synthetic receptor containing a single ITAM signaling motif|

---

CN110903401A|2019-11-20|2020-03-24|浙江大学|Second-generation chimeric antigen receptor targeting CD19, and expression vector and application thereof|

---

WO2021212069A1|2020-04-17|2021-10-21|City Of Hope|Flt3-targeted chimeric antigen receptor modified cells for treatment of flt3-positive malignancies|

---

WO2022005678A1|2020-07-02|2022-01-06|H. Lee Moffitt Cancer Center And Research Institute Inc.|Dual chimeric antigen receptor t cells targeting ccd99- and clec12a-expressing cancers|

---

CN112457416B|2020-12-15|2021-08-17|吴菲|BCMA-targeted Chimeric Antigen Receptorand application thereof|

---

CN112521513B|2020-12-15|2021-08-24|青岛西凯生物技术有限公司|Chimeric Antigen Receptortargeting CD19 and application thereof|

法律状态:
2021-12-07| B350| Update of information on the portal [chapter 15.35 patent gazette]|

优先权:

---

申请号 | 申请日 | 专利标题

---

US201762612031P| true| 2017-12-29|2017-12-29|

---

US62/612,031|2017-12-29|

---

PCT/US2018/068134|WO2019133969A2|2017-12-29|2018-12-31|Enhanced chimeric antigen receptors and uses thereof|

---